KEGG   Solanum lycopersicum (tomato): 100736536Help
Entry
100736536         CDS       T02665                                 

Gene name
MAPK7
Definition
mitogen-activated protein kinase 7
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sly  Solanum lycopersicum (tomato)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 379 aa AA seqDB search
MANQTGGASSIGSRDIRGVLINGGQYVRYNVYGNLFEVFSKYVPPIRPIGRGAYGLVCAA
VNSETREEVAIKKIGNAFDNRIDAKRTLREIKLLRHLDHENIVAIKDLIRPPKKEAFNDV
YIVSELMDTDLHQIIRSEQPLTNDHCQYFMYQLLRGLKYVHSANVLHRDLKPSNLFLNAN
CDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTGAIDVWSVGCILGEIMTR
EPLFPGKDYVQQLRLITELLGSPDDASLQFLRSDNARRYVRQLPQYPKQQFSARFPSMSA
LAVDLLEKMLVFDPTRRITVDEALCHPFLSSLHDLNDEPICPRPFSFDFDEPSITEEKIK
ELIWRECVKFYPDFVEQNI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcaaaccggtggagcttcaagtatcggcagtcgtgatatcagaggagttctc
ataaacggtggtcaatacgttcgttacaatgtttacggcaacttgtttgaagttttcagc
aaatacgttcctcctattcgtccaatcggccgcggcgcttacggccttgtatgtgctgct
gtaaattctgagacgcgtgaggaagttgcaattaagaaaataggaaatgcatttgataac
agaattgatgcgaagaggacattgagagaaattaagctacttcggcacttggatcacgaa
aatattgttgcaatcaaagacctcataaggccaccaaagaaagaggcttttaatgatgtg
tacatagtttctgaattaatggatacggatcttcatcagattattcgatctgaacagcct
ttgacaaatgatcactgccagtacttcatgtatcagctattacgtggactgaaatatgtg
cactcagcaaatgtcttacatcgtgatcttaagccaagcaatttgttcctaaatgcaaat
tgcgacctcaagattggagactttgggttggcaaggacaacttctgagacagatttcatg
actgagtacgttgtaactcgctggtatcgagcacctgaattgcttcttaactgttcagaa
tacactggagcaattgatgtttggtctgttggttgtattcttggtgaaataatgacaaga
gaacctttgtttcctggaaaagattatgtgcagcagctgagactcattactgagctacta
ggctcacctgatgatgccagccttcaatttctgagaagtgataatgcccgaagatatgtc
cgacagcttcctcaatatcctaagcaacaattttctgcaaggtttcccagcatgtctgct
ttggctgtcgatttgcttgaaaagatgcttgtttttgacccaacccgtcggattacagtt
gatgaggccctctgtcacccatttttgtcatctcttcatgacctcaacgatgagccgatt
tgtcccaggccattcagttttgatttcgacgagccctcaatcactgaagaaaagatcaag
gaactgatttggagggagtgtgtgaagttttatccggactttgttgaacaaaatatatga

DBGET integrated database retrieval system