KEGG   Solanum lycopersicum (tomato): 101244123Help
Entry
101244123         CDS       T02665                                 

Definition
protein disulfide isomerase-like 2-1-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:sly04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 359 aa AA seqDB search
MGRSQICSALAILALFFFSSALADDVVVLTEENFDKEIGQDRAALVEFYAPWCGHCKKLA
PEYEKLGASFKKAKSVLIGKIDCDEHKSVCSKYGVQGYPTIQWFPKGSLEPKKYEGARSA
EALAEYVNSEAGTNVKIASIPSSVVVLSSDNFDEIVLDETKDVLVEFYAPWCGHCKSLAP
IYEKVATAFRQEEDVIIANLDADNHKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDAD
DFVNFINEKCGTSRDSKGQFTSKAGIVESLDTLVKEFVGATNEEKKAVFSKMEDEAGKLK
GSAARYGKIYLKAAKSSMEKGADYANNEIQRLERMLAKSISPTKADEFTLKKNILATFA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggggagatcacagatctgtagtgctttagcaattttagctttgttcttcttctcttca
gctttggcagatgatgtcgttgttttgaccgaagaaaacttcgacaaggagatcggtcaa
gatcgcgctgctctcgttgagttctacgctccttggtgtgggcactgtaaaaagcttgct
cctgagtatgaaaagcttggtgcaagtttcaagaaagcaaagtctgttttgatcggaaag
attgattgtgatgaacataagagtgtttgcagcaaatatggggttcaaggttaccccact
atccaatggtttccaaagggatcactggagccaaaaaaatacgaaggtgcacgatctgct
gaagcccttgccgagtacgtgaacagcgaagcagggactaatgtgaagattgcttctatc
ccgtctagcgttgtggtgctatcttcagataactttgatgaaattgtgctagatgagacc
aaggatgtgttggttgaattttatgcaccatggtgtggtcattgcaaaagccttgctcct
atttacgaaaaggtagctacagcgttcaggcaagaggaagatgttattattgcgaacctt
gatgccgataatcacaaggatcttgcagagaagtatggtgtaagtggctatcccacactg
aaattcttccccaagggaaacaaagctggtgaggattatgatggtggccgagatgcagat
gactttgtgaacttcatcaatgagaagtgtggaactagccgtgattcaaaaggacaattt
acttcaaaggcgggtattgtcgaatcactggatacattagtgaaggagttcgtcggtgcc
acaaacgaggaaaaaaaagctgtatttagcaagatggaagatgaagctggaaaactgaag
ggttctgctgcaaggtatggcaagatttacctaaaggctgccaagagttccatggaaaaa
ggagctgattacgccaacaatgagattcagcgattagagcgcatgcttgccaagtcaatc
agccccactaaggcggatgagttcaccctcaagaagaacattttggcgacgtttgcataa

DBGET integrated database retrieval system