KEGG   Solanum lycopersicum (tomato): 101244293Help
Entry
101244293         CDS       T02665                                 

Definition
delta-1-pyrroline-5-carboxylate synthase-like
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    101244293
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101244293
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     101244293
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     101244293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 717 aa AA seqDB search
MDSADPARAFVKDVKRIIIKVGTAVVTRGDGRLALGRMGSLCEQIRELTSQGFEVILVTS
GAVGVGRQRLRYRKLINSSFADLQKPQGDLDGKACAAVGQNGLMALYDTLFSQLDVTSAQ
LMVTDNDFRDPDFRRQLNETVNSLLCLKVVPIFNENDAISTRKAPYEDSSGIFWDNDSLA
ALLALELKADLLVLLSDVEGLYTGPPTDPQSELIHTYVKEKHEGLITFGDKSRVGRGGMT
AKVKAAVYAAYAGIPVVITSGFANNNIIKALDGQRVGTLFHREAIKWASIGDFDAREMAV
SARECARRLQTLSSQERSKILLDIADALEAKEEEILAENEADVAAAQQAGYENALISRLA
MKPGKISSLANSVRVLANMDEPVGRILKRTELADGIILEKTSSPLGVLLIIFESRPDALV
QIASLAVRSGNGLLLKGGKEAKRSNAILHKVITSSIPPIVGERLIGLVTSREEIPELLKL
DDVIDLVIPRGSNKLVSQIKAATKIPVLGHADGICHVFIDKSADLDMAKRIVLDAKTDYP
AACNAMETLLVHEDLVQTGGLNDLILELQEKGVSLFGGPKASSVLNIPEANSFHHEYGAL
ACTVEIVEDVNTAIEHIHRHGSAHTDSIITEDKEVAELFLRQVDSAAVLHNASTRFSDGF
RFGLGAEVGISTSRIHARGPVGVEGLLTTRWLARGSGQVVDGDKEIVYTHKDLNLEA
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggattccgctgatcctgctcgggcatttgtaaaggatgtcaaacgaatcattattaag
gttggaactgccgtggttacccgaggtgatggaagattagcacttggaagaatgggatca
ctgtgtgagcagattcgggaacttacctctcaaggctttgaagttattttggtcacctca
ggtgctgttggtgttggccgtcagcgccttcgatataggaagcttattaatagcagcttt
gcggaccttcaaaagcctcaaggtgatcttgatggcaaggcttgtgccgctgtaggtcag
aatggcctcatggctctgtatgatacgttgttcagtcagttggatgtaacctcagctcag
cttatggtgactgataatgactttagagatccagattttaggagacaactcaatgaaact
gtaaactcattgctctgtctaaaagttgtacctatatttaatgagaacgatgctatcagc
acgcggaaagctccttatgaggattcttctggaatcttttgggataatgacagtttggca
gctctattggctttggagctaaaagctgatctgcttgttttgttgagtgatgttgaaggc
ctttacactggccctccaaccgatccacaatcagagctaattcatacatatgttaaggag
aagcatgagggattgattacttttggagacaagtctagagttggaagaggtggtatgact
gccaaggtaaaagctgcagtttatgcggcttatgctggcattcccgttgtgataactagt
ggctttgccaacaataatatcattaaagcactagatggacaacgtgttggcactctcttt
catcgtgaagccattaaatgggcatcaataggagattttgatgctcgagagatggcagtt
tctgcgagggaatgtgccaggcggcttcagaccctctcttctcaagaaaggagtaaaatt
ttgctagatatagctgatgcactggaagcaaaagaagaagaaatcctggctgaaaatgaa
gctgatgtggctgcggctcaacaagctggatatgagaatgctttgatatctcggttagct
atgaaaccaggaaaaatttcaagtcttgcaaactcagtccgtgtgcttgctaacatggat
gagccagttggccgcattttaaagaggacggagcttgctgatggaatcatattggagaaa
acatcatctccattgggtgttctcctgattatatttgagtcacgacctgatgcactggta
cagatagcttctctagcagtccgaagtgggaatggccttttgttgaaaggagggaaggag
gctaaaagatcgaatgcaattttacacaaggtgattacctcatccattcctccaattgtt
ggtgaaagacttattgggttagtgacttctagagaagagatccctgaattgcttaagctt
gatgatgtgattgatcttgttattccaagaggtagcaataaacttgtttctcaaattaaa
gctgcaacaaaaattcctgttcttggccatgctgatggtatttgccacgttttcattgat
aagtctgctgacttggatatggccaaacgtattgtgttggatgcaaaaacagattaccca
gcagcctgcaatgcaatggaaacacttctcgttcatgaggatctggtgcaaactggaggt
cttaatgacctgattctggaacttcaggaaaaaggtgtatctttgtttggtggacctaaa
gcaagctcagttcttaatattcctgaagcaaattccttccatcatgaatatggtgcactg
gcttgcaccgtggaaattgttgaagatgtgaatactgcaatagagcacatacatcgtcat
ggaagtgctcacactgatagcatcattactgaagacaaagaagttgctgaactgttttta
cgtcaagttgacagtgctgctgtacttcataatgcaagcacaagatttagtgatgggttc
cgctttggacttggtgcagaggtggggattagtacaagtcgcattcatgctcgtggtcca
gttggagttgagggattgctgacaactagatggcttgcaaggggatctggacaagttgtt
gatggtgataaagaaattgtatacactcacaaagaccttaatctggaggcttga

DBGET integrated database retrieval system