KEGG   Solanum lycopersicum (tomato): 101244818Help
Entry
101244818         CDS       T02665                                 

Definition
uncharacterized LOC101244818
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101244818
   00500 Starch and sucrose metabolism
    101244818
Enzymes [BR:sly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101244818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 663 aa AA seqDB search
MGVAGVLEAALLYAIHDAIVENILFEDGNGANTFQYCSNLDDLTGTLKDFENEEREEVEF
ISTTSSQGLHLKKFTSIHDSSTKRYRIECSILRQRIDIPNPLHPSLCIALDFVFDSLAVK
LVSVHQHGYEILSLGIGRDKTSYCWRDVKLCPENNKRRNGRIQVFFRKGVAYCIWYIDDD
DMEIDVLDMVNETYIGHTTLPRGGFFARPSLMDWNGQLSFVEQVKDELRVLVLKDYRKLR
WDETTRIMKLNFLKEELMTFIAFADNSVLFYMKQDKKSFCSYDMSTGIQNTSVLSGLIES
SEDVMDVIVMNVLQELLKKTMNKRNFSSFYHLILILLICCNTSTNLAMAANNSSTNFSTA
ILIRVDQSGQGDFKKIQDAIDAVPSNNTELFFIWVKPGTYREKIVVPADKPFITLSGTEA
SNTIITSSEGGDITESPTVTVLASDFVARYLTIQNLFGTSGKAVALKVKGDRGAFYSCRI
QSYQDTLLDDSGRHYYNNCYIEGAVDFIFGSAASLYERCHIHSVAAGAITAQGRETPLEN
SGFTFLGCKITGTGGNTSLGRPWGSYSRVVFAYTFMANIIQPEGWNDWGDSTKQSTSYYG
EYKCYGPGANRSKRVVWSRSLSNEDAAPFLTKNMIGGRSWLRPTPTHFKRSGSTNIVTSA
GEN
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggagttgccggtgtattggaggctgctttgctatacgccattcatgatgctatcgta
gaaaatattttatttgaagacggtaatggtgcaaatacattccaatattgttcaaacttg
gatgatctcactggcactttgaaggatttcgaaaacgaggagagagaggaagtagagttt
attagtactacgagtagtcaaggcttacatctcaagaaatttactagcattcatgattct
tctactaagagataccgcattgaatgttctatattacgacaaaggattgatatccccaat
ccactacatcctagtttatgcatcgccttggatttcgtcttcgatagcctagctgtcaag
ttggtttctgttcatcaacatggttatgaaatcctctctcttggaattgggagggataaa
actagttattgttggcgagatgtgaagctgtgtcctgaaaacaacaagaggaggaacgga
agaattcaggttttctttagaaagggagtcgcttattgcatttggtatattgatgatgat
gatatggaaattgatgttttggatatggttaacgagacctacattggtcatactactttg
cctagaggaggtttcttcgcccgccctagtctcatggattggaatggccagctctcgttc
gttgaacaagtaaaagatgagctccgtgttttggtattaaaggattacagaaagttgaga
tgggatgaaacaacacggatcatgaagctgaatttcttgaaggaggagttgatgacattt
atcgcttttgctgacaactctgttttgttctacatgaagcaggacaagaaatctttctgc
tcctatgacatgagtacgggaattcagaatactagtgtattgtcagggttgatcgagtcc
tctgaagatgtcatggatgtgatagtgatgaatgttcttcaagagttgttaaaaaaaaca
atgaacaaaaggaatttttcaagtttctatcatcttatattaattctactcatttgttgt
aatacgtcaactaatttagccatggctgcaaacaactctagtacaaatttttccacagcc
attctaattagagtggaccaatcaggccagggagatttcaaaaaaattcaagatgctatt
gatgctgttccatcgaataatactgaattattcttcatttgggttaagccagggacttac
agagagaagattgtggtacctgctgataagccattcatcacgttgagtggaacagaggct
tctaacacaataattacatctagtgaaggtggagatattactgaatctcctacagtcact
gtattagcctccgattttgttgcaagatatttaacaatacagaatttattcggaacgagt
ggcaaagccgtggcacttaaggttaaaggagatagaggtgcattctatagttgtagaatt
caatcgtatcaagacactttgttagacgatagtggtaggcattattacaacaattgttac
attgaaggggccgttgattttattttcggtagcgcagcttctctctatgaaaggtgtcat
attcattcagttgcagcaggggcaatcacagctcaaggcagagagacccctttagaaaat
tcaggatttacatttttaggttgcaagataacaggtacaggagggaacacttcactagga
agaccatggggttcatattctagggttgtttttgcctacacatttatggctaatatcata
cagccagagggatggaatgactggggagattctaccaagcaaagcacttcgtactatggt
gaatacaagtgttatggaccgggtgctaatagatcaaaaagggtggtttggtcacgtagc
ttatcgaacgaggacgccgcgccatttctgaccaagaatatgattggcgggcgaagttgg
ttaaggcccaccccgacccatttcaaaagatcaggctcaacaaatattgttacttctgct
ggagaaaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system