KEGG   Solanum lycopersicum (tomato): 101245292Help
Entry
101245292         CDS       T02665                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101245292
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101245292
Enzymes [BR:sly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101245292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 993 aa AA seqDB search
MVSGTLFHYRKNSWPPEEYITKATLQLFDFDSAAPPSQAWRRKLNSRASKLKEFSVTFTE
AIKMVRLGIRLWSYVREEASYGRRAPIDPFTRERCKPSASQGVPLGGMGSGSISRGFRGE
FKHFQILPGTCETSPIMSNQFSIFISRDGGNKKYASVLSPGEHEGLGKASDHGISSWGWN
LSGQHSTYHALFPRAWTVYDGEPDPELKVSCRQISPFIPHDYSESSLPTSVFVYTLRNTG
KERAQVSLLFTWTNSIGGVSHLSGDHVNEPFIGEDGVSGVLLHHKTKENPPVTFAVAACE
TQNVSVTVLPCFGLTEGSCVTAKDMWGKMVQDGHFDRENSSKGPSMPSSPGDTHCAAVSA
AAWVEPHGKCTVAFAVAWSSPQVKFMKGKSYYRRYTRFYGTSERAAVDLVHHSLTNYKLW
EEEIEKWQNPILNDNKLPEWYKFTLFNELYFLVAGGTVWIVQISQIQALPVRELGVITHL
LTDILPVQHVALGTKSGLFFLNPLNHDGDFFFTLTFVDSGVPSSDSVSTRTARPEVTKVK
SIKKGVQVEQTAYNGYGEDIQLSSSDKLSGSSTDSDDVGRFLYLEGVEYIMWCTYDVHFY
ASFALLALFPKIELSIQREFAKAVLCEDGRKVKFLAEGNWGIRKPRGAIPHDLGMHDPWH
EMNAYNIHDTSKWKDLNPKFVLQVYRDFAATGDFSFATDVWPSVCAAIEYMDQFDHDNDC
LIENDGFPDQTYDTWTVHGISAYCGGLWLAALQAAAAMAMHVGDYAFAEKCKGKLIKAKT
VYEEKLWNGSYFNYDSGSSSNSKSIQADQLAGQWYMASSGLPDLFDAVKIKSTLQKIYDF
NVMKVRGGRMGAVNGMHPNGKVDDTCMQSREIWTGVTYGVAATMLHAGMEEQAFNTAEGI
FTAGWSEDGYGYSFQTPEGWTTDGHFRSLIYMRPLSIWGMQWALSMPKTILDAPKVNIMD
RIQVKPHTPQETGVQKIVKKAKCFNNSIFSCSC
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtggtactttgtttcattataggaagaactcatggccacctgaggagtacata
actaaagcaactttgcaattgtttgattttgatagtgctgcaccaccatctcaagcttgg
agaaggaaactaaacagccgtgctagcaagttaaaagaatttagtgtcacattcacagag
gcaataaaaatggttcggcttggtatacggttatggtcatatgtaagggaagaagcgtcc
tatggaaggagagctccaattgatccctttacacgagaacgctgcaaaccatcagcatct
cagggtgttccacttggagggatggggagcggcagcatatccagaggttttagaggcgag
tttaagcactttcagattcttcctggaacatgtgagacttctccaatcatgtccaatcag
ttctcaatattcatatctcgggacggaggaaacaaaaagtatgcatccgttttatctccg
ggagaacatgaagggctagggaaggctagtgatcatggtatatcatcatggggctggaat
ctaagtggacagcattctacatatcatgcactctttcctcgggcttggacagtatatgat
ggtgaaccagatccagaactgaaagtttcttgtcgtcaaatatcaccgttcatcccacat
gactacagcgagagcagtcttcctacatcagtttttgtttacacattgaggaacactggg
aaggaaagagcacaagttagccttctttttacatggacgaattcaattggtggtgtctca
cacctatcaggagatcacgtgaacgaaccatttataggtgaagatggagtctctggcgta
ctcctacatcacaagacaaaagaaaatcctcctgttactttcgctgtagctgcatgcgaa
actcagaatgtcagtgtaactgttttaccctgtttcggcctgactgagggtagctgtgta
acagcaaaggatatgtggggtaaaatggtgcaggatgggcactttgatcgagagaactcc
agcaaaggaccaagcatgccatcatcacctggggacacacattgtgctgctgtttctgca
gctgcatgggttgaaccacatggaaaatgtaccgtggcattcgctgttgcttggtcatct
cctcaagttaaattcatgaaagggaagtcatactataggcggtacacaaggttttatgga
acctcagaaagggctgctgtagatttggttcatcattcattgacaaattataagttgtgg
gaagaagaaattgaaaaatggcaaaatcctatccttaatgataataagctaccggaatgg
tacaagtttacgctgtttaacgagctatattttctggtggctggtggaacagtttggatt
gttcagatatctcaaatacaagctctacctgtgagagagttgggtgttatcactcatttg
ttgactgacatactacctgtccaacatgttgctctaggaacaaagagtgggttattcttt
ttaaatcctttaaatcacgatggtgattttttctttaccctcacttttgtagactctggt
gttccttcttcagactcggttagtaccagaacagcgagaccggaagtaactaaagttaaa
tcgattaaaaagggtgtacaagtggagcagactgcatataatggttatggggaagacatc
cagttgtcaagttctgataagttatcagggtcaagtactgacagtgatgatgtgggtagg
tttctatacttggaaggagtagaatatattatgtggtgtacatatgatgtgcacttctat
gcctcgtttgcgcttcttgctttatttcctaaaattgagctcagcattcagcgggaattt
gccaaagccgtcttatgtgaagatgggagaaaagtgaagtttctggcagagggtaattgg
ggaatacggaagcccaggggcgctattcctcatgatcttggaatgcatgatccttggcac
gaaatgaatgcctataacatacatgatactagtaaatggaaggacctcaatccaaaattt
gtgcttcaggtctatagggactttgctgcaactggagatttttcctttgctacagacgtc
tggccttctgtatgtgctgcaattgagtatatggatcaatttgatcatgacaatgattgt
ctaattgaaaatgatggtttccctgatcaaacatatgatacatggacagttcatggaata
agtgcttactgtggtggtttatggcttgctgctcttcaagctgcagctgcgatggccatg
cacgtgggcgactatgcctttgcagaaaaatgcaaaggcaaattgataaaagccaagaca
gtatatgaggaaaaattatggaatggctcatattttaactatgacagtggttctagtagt
aacagtaagtcaatccaggctgatcagctagctggtcagtggtatatggcatcttctggc
ttgcctgatctctttgatgctgtaaagatcaagagtactcttcaaaagatttacgacttc
aatgtcatgaaagttcgtggaggcagaatgggtgcagtaaatggaatgcatccaaatgga
aaggtggatgatacttgcatgcaatctcgtgagatatggactggtgtcacatatggtgtg
gctgccaccatgcttcatgctggtatggaggaacaggcattcaatacagctgaaggcata
ttcaccgcaggctggtcagaggatggctatggatactcatttcaaacacccgaaggttgg
actactgatggacattttcgatctctgatatatatgaggcctctctcaatttggggcatg
caatgggcattatcgatgcctaagacaatccttgatgcccctaaggtcaatataatggac
agaattcaagtgaaaccccacacacctcaggagacaggtgtccagaaaatagtcaaaaaa
gcaaaatgttttaacaattctatcttcagctgttcttgctaa

DBGET integrated database retrieval system