KEGG   Solanum lycopersicum (tomato): 101245535Help
Entry
101245535         CDS       T02665                                 

Definition
pectinesterase 31-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101245535
   00500 Starch and sucrose metabolism
    101245535
Enzymes [BR:sly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101245535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 317 aa AA seqDB search
MSSRVSVTVSQDGTCDYRTVQEAIDAVPLSNKCRTVIRVAPGVYKQPIYVPKTKNYITLV
GLSPEATVLTWNNTATKIDHHQAARLIGTGTFGCGSTIVEGEDFIAENITFENSVPEGSG
QAVAIRVTADRCAFYNCRFLGWQDTLYLHYGKQYLKDCYIEGSVDFIFGNSTALLEHCHI
HCKSAGFITAQSRKSSQETTGYVFLRCVITGSGATSYTHLGRPWGPFGRVVFAYCYMDHC
IKHVGWNNWGKTENERTACFYEYRCYGPGSCPSKRVTWARELMDEEAEQFVMHGFIDPDQ
QSPWLCQRMALRIPYSA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgagggtgtcggtaacagtttcacaagacggaacttgtgattacaggactgtg
caagaagccatagacgccgttccactatcaaataagtgtcgcactgtgattcgtgtagcg
cctggtgtttataagcagccaatttatgtcccgaagacgaaaaattacattacacttgtt
gggcttagtcctgaagctactgttctcacctggaataatactgccactaaaattgatcac
catcaggcagcaaggttaattggtactggtacatttgggtgtgggagtacaatagtggaa
ggagaggattttattgctgagaacatcacctttgaaaactctgttcctgagggatcagga
caggcagtggcaatcagagttacagctgatcgttgtgcattttataattgcagatttctt
ggttggcaggatacgttgtatttgcactacgggaagcaatatttgaaagattgctatatc
gaaggaagtgtagattttatttttggtaatagtactgctctcttagagcattgtcacata
cactgcaaatcggcaggattcattactgcacaaagcaggaaatcttctcaagagacaact
ggttatgtgtttctgagatgtgtgatcactggtagcggagcgacctcatatacacatctt
ggacgcccatgggggccttttgggagggtggtttttgcctattgttatatggatcactgt
attaagcatgtcggttggaacaactggggtaaaacagaaaatgagagaactgcttgcttc
tatgagtaccggtgttatggaccgggtagttgcccgtcaaaacgtgtcacctgggccaga
gaattgatggatgaagaagcagaacaatttgtcatgcatggcttcattgatcctgatcaa
caaagcccttggctgtgtcagaggatggcgctgcgcataccatattcagcttaa

DBGET integrated database retrieval system