KEGG   Solanum lycopersicum (tomato): 101245995Help
Entry
101245995         CDS       T02665                                 

Definition
endoglucanase 24-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101245995
Enzymes [BR:sly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     101245995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 496 aa AA seqDB search
MKRNIISSKLMLLLLLLLPLLNCHGSYLDYTEALTKSILFFEGQRSGYLPQDQRMSWRGH
SGLSDGWEMNVDLTGGYYDAGDNVKFNFPMAFTTTLLAWSVIEFGEIMPPAELRNGLVAI
RWSTDYLLKTVSQPDRIFVQVGDPVLDHDCWERPEDMDTARTVYTVDAPNPASDVAGETA
AALAAASIAFRPSDPGYAETLLRTSTRVFDFADRNRGAYSDNNNIREGVCPYYCDFDGYQ
DELLWGAAWLRRATQRDDYLSYIQENRQTLGADDNINEFGWDNKHAGVNVLVSKEVLDGT
TYSLQSYKASADSFMCTLIPESSSSHIQYSPGGLIYKPGGSNLQHATTITFLLLVYANYL
EKSSQILNCGTISVSPSMLRKIGKRQVDYILGENPKGISYMVGYSNYYPQKIHHRGSTIP
SIKDHPQVIGCNEGSIYFNSSQPNPNVLVGAIVGGPGEDDVYDDNRDEFRKSEPTTYINA
PFVGALAYFAANPNVN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaatataatttcttcaaaattaatgctgcttcttctccttcttcttccatta
ttaaactgccatggaagctaccttgattatacagaagcattaaccaaatccattctcttc
ttcgaaggccaacgctccggctatttaccgcaggaccagagaatgagctggcgaggacat
tccggtttaagcgatggatgggagatgaatgttgatttgaccggcggttactacgacgcc
ggagataatgtgaagtttaattttccgatggcgtttacgacgacgttgcttgcgtggagt
gtaattgaatttggggaaattatgccgcctgctgaattacggaatggtttagtcgctatc
cgttggtccactgattatcttctcaaaactgtttctcagccagatcgcattttcgtccag
gtgggtgatcctgtactggaccatgactgttgggaaaggccagaagatatggacactgct
aggacagtgtacacagtggatgccccgaatccggcatctgatgtggccggagagactgca
gctgccctggcagctgcatctatagctttccggccctcagatcccggatacgcagagaca
cttttgagaacatccacaagggtgtttgattttgcagataggaaccgtggagcttacagt
gataataacaatattagagaaggagtttgtccatattattgtgattttgatggatatcag
gatgaattgttgtggggagcagcgtggctaagaagggctacgcaaagagacgattatcta
agttacatacaagaaaatcggcagacacttggtgcggatgacaatattaatgaatttgga
tgggataataaacacgcaggcgtaaatgttcttgtttccaaggaagtgttggatgggacc
acgtactcccttcaatcttataaagcatcagcagatagcttcatgtgtacattaatccca
gaatcatcatcttctcatatacaatactctcctggtggactaatttacaagcctggtgga
agcaatttacaacatgccacaacaatcacattcctactactagtctacgcaaattactta
gaaaaatcatcacaaatattgaattgtggtactataagtgtgagtccatcgatgcttcga
aaaattggtaagagacaagtcgattacattttaggtgaaaatcctaaaggtatatcatac
atggttggttatagtaattactatcctcaaaaaattcatcatcgcggatcgactattcca
tcgatcaaagatcatcctcaggtcattggatgcaacgagggctcgatttattttaactca
tcgcagcctaatccaaatgttttagttggtgcaattgttggtggtcctggagaagatgat
gtttatgatgataatagagatgaatttcgtaaatctgagccaactacttatattaatgca
ccatttgttggtgcacttgcttactttgcagctaatcctaacgttaattag

DBGET integrated database retrieval system