KEGG   Solanum lycopersicum (tomato): 101246035Help
Entry
101246035         CDS       T02665                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101246035
   01210 2-Oxocarboxylic acid metabolism
    101246035
   01230 Biosynthesis of amino acids
    101246035
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101246035
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101246035
   00220 Arginine biosynthesis
    101246035
Enzymes [BR:sly01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101246035
Amino acid related enzymes [BR:sly01007]
 Aminotransferase (transaminase)
  Class I
   101246035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 575 aa AA seqDB search
MRKVVKKLVNRKRSPFFTLRPLFAKSIMRRFVADKAKTLINRSRTTCSSSFPPPIITSTS
VLQRLTSSSSSSSQSTAVLRFLSTSSDSMASDYSSTPVTLNNVNPKVLKCEYAVRGEIVN
LAQKLQQDLKENPGSHPFDEILYCNIGNPQSLAQQPITFFREVLALCDHPLILDKSETQG
LFSADSIERAFQILDQIPGRATGAYSHSQGIKGLRDTIASGIEARDGFPADPNDIFLTDG
ASPAVHMMMQLLIGSENDGILCPIPQYPLYSASIALHGGTLVPYYLDEETGWGLEVSELE
NQLKTAKSKGINVRALAVINPGNPTGQVLAEANQREIVEFCKKEGLVLLADEVYQENVYV
PEKQFHSFKKVARSMGFGEKDISLVSFQSVSKGFYGECGKRGGYMEVTGFSPEIREQIYK
VASVNLCSNISGQILASLVMSPPKVGDESYESFAAEKEGILSSLARRAKTLEDAFSNLEG
VTCNKAEGAMYLFPRINLPDKAIKAAEEAKIAPDAFYARHLLNATGIVVVPGSGFGQRPG
TWHFRCTILPQEEKIPAIVSRLTEFHKLFMDEFRG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaagtggtaaaaaagttggtgaatcgtaaacgttcaccgttcttcactctccgc
ccactgttcgccaaatccataatgcggagattcgttgctgataaagccaaaactctcatc
aataggagcaggaccacctgttcgtcttcttttcctcctcctattattacttctacttcc
gtgttgcagcggctcacctcttcttcttcttcttcatctcaatcaactgctgttcttcgt
tttttatccacttcttctgattcaatggcttccgattattcatccactccggtcactctt
aacaacgttaacccaaaggttttgaaatgtgaatatgctgtccgaggagaaatagtcaac
cttgctcagaaattacaacaagacctcaaggagaatccaggctctcatccctttgatgag
atcttatactgcaatattggaaatcctcaatccctggctcagcagcctattactttcttt
agggaggtccttgcattatgtgatcatccacttattttggacaaaagtgaaactcaaggt
ttgttcagtgcggattcaatagaacgagcttttcagatcctcgaccaaattcctggtaga
gcaacaggtgcatacagccacagtcagggtatcaaaggattacgtgatacaattgcttct
ggtatcgaagctcgtgatggcttccctgccgatccaaatgatattttcttgactgatggt
gcaagccctgcggttcacatgatgatgcagttgctcatcgggtcagagaatgacggaatt
ctctgtcccatcccccaatatcctctttattctgcttcgattgctctccatggtggcact
ctcgttccttattatcttgatgaggaaacaggatggggacttgaggtctcagagcttgag
aatcagctgaaaactgcaaaatctaagggtattaacgttagggctttggctgtgatcaat
ccaggcaacccaactgggcaggttctcgctgaggctaaccaacgagaaattgtggaattc
tgcaagaaagaaggccttgttcttctggcggatgaagtgtatcaggaaaatgtttatgtg
cctgagaagcagttccactcatttaagaaagttgcccgctctatgggatttggagaaaag
gacatctctttagtttcttttcagtctgtgtctaaaggattctatggagagtgtggaaag
cgaggaggttacatggaggttactggatttagccctgagataagagaacagatatacaaa
gtggcatctgtcaatctgtgttccaacatttctggtcagattcttgcgagccttgtcatg
agccctccgaaggtgggtgatgaatcatacgagtcttttgctgctgagaaagaagggata
ctttcatccttggcaagacgtgcaaagacactagaagatgcattcagtaatttggaggga
gtaacatgcaataaagcagagggtgcaatgtatctatttccacgtatcaacttacctgac
aaagcaataaaagcagcagaagaagctaaaattgcaccagatgcattttatgctcggcac
ctccttaatgctaccggaattgttgttgtcccaggctctggatttggccagcgtcctgga
acgtggcattttaggtgcacaatattaccgcaagaagagaagataccagctattgtatct
cgtcttacagaattccataagctgttcatggatgaattccgcggctaa

DBGET integrated database retrieval system