KEGG   Solanum lycopersicum (tomato): 101246116Help
Entry
101246116         CDS       T02665                                 

Definition
(RefSeq) glutamate dehydrogenase A
  KO
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101246116
  Energy metabolism
   00910 Nitrogen metabolism
    101246116
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101246116
   00220 Arginine biosynthesis
    101246116
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101246116
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101246116
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101246116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 411 aa AA seqDB search
MNALAATNRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN
ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCNPKDLSVSELERL
TRVFTQKIHDLIGVNTDVPAPDMGTNAQTMAWILDEYSKFHGHSPAIVTGKPIDLGGSLG
REAATGRGVVYATEALLAEYGKHVKDLTFAIQGFGNVGAWAGKLIHERGGKVVAVSDITG
AIKNSNGIDIPALLSHKEKTGKLIDFAGADVMNSDELLTHECDVLIPCALGGVLNRENAD
NVKAKFIIEAANHPTDPDADEILSKKGVVILPDIYANAGGVTVSYFEWVQNIQGFMWDEE
KVNRELKKYMTRAFHNLKGMCHSHNCNLRMGAFTLGVNRVARATQLRGWEA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctgcaaccaaccgcaatttccgacaagccgctcgaattcttggcttg
gattccaaaatcgaaaagagtcttctcattcctttcagagaaattaaggtggaatgcaca
attcccaaggatgatggaacgttggtttcctatgttggatttagagtgcagcatgataat
gctcgtggccctatgaaaggcggaatcagataccatcctgaggttgacccagatgaggta
aatgcccttgctcaactgatgacttggaagaccgctgtagccgacatcccatatggggga
gctaaaggtggaatcggctgtaacccaaaggatttaagtgtgagcgagttggagcgactt
actcgtgttttcacacagaaaattcatgatctaattggagttaatactgatgtgcctgcc
cctgatatgggcactaatgctcagactatggcctggattttggacgagtactcaaaattt
catggtcactcaccagccattgtgactggaaaaccaattgatcttggagggtcattggga
agagaagctgcaacagggcgtggcgtcgtctatgctacagaagctttacttgctgaatat
gggaagcacgttaaggatttgactttcgcaattcagggatttggaaatgtaggagcctgg
gcaggaaagctcattcatgagagaggtggaaaggtagttgcagtgagtgacataactgga
gcgatcaagaactccaatgggatcgatataccagctttactcagtcataaagaaaaaaca
ggaaagctcatcgattttgctggtgcggatgtgatgaattctgatgaattgctaacgcat
gaatgtgacgttctcatcccttgtgctttgggaggagttttgaacagagaaaatgctgat
aacgtcaaggccaaattcattatagaagcagcaaaccatcctactgatccagatgctgat
gagattttatcgaagaaaggagtagtaatacttccagacatctatgccaatgctggagga
gtgactgtcagctattttgaatgggttcagaatattcaaggatttatgtgggatgaggag
aaggttaatagggagcttaagaaatacatgacaagagcctttcataacctcaagggcatg
tgccattcacataattgcaatcttcggatgggtgcattcacattgggggtgaatcgtgtt
gcgcgtgccactcaattaagaggttgggaggcataa

DBGET integrated database retrieval system