KEGG   Solanum lycopersicum (tomato): 101246116Help
Entry
101246116         CDS       T02665                                 

Definition
(RefSeq) glutamate dehydrogenase
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00220  Arginine biosynthesis
sly00250  Alanine, aspartate and glutamate metabolism
sly00910  Nitrogen metabolism
sly01100  Metabolic pathways
sly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    101246116
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101246116
   00220 Arginine biosynthesis
    101246116
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101246116
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101246116
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101246116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N
Motif
Other DBs
NCBI-GeneID: 101246116
NCBI-ProteinID: NP_001311437
UniProt: K4BIS6
Position
3
AA seq 411 aa AA seqDB search
MNALAATNRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN
ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCNPKDLSVSELERL
TRVFTQKIHDLIGVNTDVPAPDMGTNAQTMAWILDEYSKFHGHSPAIVTGKPIDLGGSLG
REAATGRGVVYATEALLAEYGKHVKDLTFAIQGFGNVGAWAGKLIHERGGKVVAVSDITG
AIKNSNGIDIPALLSHKEKTGKLIDFAGADVMNSDELLTHECDVLIPCALGGVLNRENAD
NVKAKFIIEAANHPTDPDADEILSKKGVVILPDIYANAGGVTVSYFEWVQNIQGFMWDEE
KVNRELKKYMTRAFHNLKGMCHSHNCNLRMGAFTLGVNRVARATQLRGWEA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctgcaaccaaccgcaatttccgacaagccgctcgaattcttggcttg
gattccaaaatcgaaaagagtcttctcattcctttcagagaaattaaggtggaatgcaca
attcccaaggatgatggaacgttggtttcctatgttggatttagagtgcagcatgataat
gctcgtggccctatgaaaggcggaatcagataccatcctgaggttgacccagatgaggta
aatgcccttgctcaactgatgacttggaagaccgctgtagccgacatcccatatggggga
gctaaaggtggaatcggctgtaacccaaaggatttaagtgtgagcgagttggagcgactt
actcgtgttttcacacagaaaattcatgatctaattggagttaatactgatgtgcctgcc
cctgatatgggcactaatgctcagactatggcctggattttggacgagtactcaaaattt
catggtcactcaccagccattgtgactggaaaaccaattgatcttggagggtcattggga
agagaagctgcaacagggcgtggcgtcgtctatgctacagaagctttacttgctgaatat
gggaagcacgttaaggatttgactttcgcaattcagggatttggaaatgtaggagcctgg
gcaggaaagctcattcatgagagaggtggaaaggtagttgcagtgagtgacataactgga
gcgatcaagaactccaatgggatcgatataccagctttactcagtcataaagaaaaaaca
ggaaagctcatcgattttgctggtgcggatgtgatgaattctgatgaattgctaacgcat
gaatgtgacgttctcatcccttgtgctttgggaggagttttgaacagagaaaatgctgat
aacgtcaaggccaaattcattatagaagcagcaaaccatcctactgatccagatgctgat
gagattttatcgaagaaaggagtagtaatacttccagacatctatgccaatgctggagga
gtgactgtcagctattttgaatgggttcagaatattcaaggatttatgtgggatgaggag
aaggttaatagggagcttaagaaatacatgacaagagcctttcataacctcaagggcatg
tgccattcacataattgcaatcttcggatgggtgcattcacattgggggtgaatcgtgtt
gcgcgtgccactcaattaagaggttgggaggcataa

DBGET integrated database retrieval system