KEGG   Solanum lycopersicum (tomato): 101246236Help
Entry
101246236         CDS       T02665                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101246236
Transfer RNA biogenesis [BR:sly03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101246236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 565 aa AA seqDB search
MAAAAVAVAETRKLPRPGRGGVVSLGLTEEEARVRAITEIVNNMVELSRKGKDVDLNALK
SAACRKYGLSRAPKLVEMIAALPDSERETLLPKLRAKPVRTASGIAVVAVMSKPHRCPHI
ATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSV
DKVEFILMGGTFMSLPAEYRDYFTRNLHDALSGHTSANVEEAVAYSEHGATKCIGMTIET
RPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVV
AHMMPDLPNVGVERDLESFKEFFESPSFRTDGLKIYPTLVIRGTGLYELWKTGRYRNYPP
EQLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVR
TREAGIQDIHNKIRPEEVELVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTC
PELTGRCSIVRELHVYGTAVPVHGRDTDKLQHQGYGTLLMEEAERIARREHRSTKIAVIS
GVGTRHYYRKLGYELEGPYMVKNLV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggtagcggtagcggagacccggaagctcccgcggccgggaaggggc
ggagttgtttccctcggcctgacagaagaagaagctagagttcgtgctataacggagatc
gttaacaacatggtggaactctcacggaaaggcaaggatgttgacctaaatgcgctaaag
tcagcagcgtgccgaaaatacgggctctctcgggctcctaagttggtagagatgatcgct
gctttgcctgactctgaacgtgaaacactgcttcccaaactccgagccaagcctgtccgt
acagcctctggaatagctgtcgtagctgtaatgtccaagcctcatcgttgtcctcatata
gctaccaccggaaacatttgtgtctattgccctggcggccccgattctgattttgagtac
agtacacagtcatacacgggatatgaacctactagtatgcgagctattcgagctagatac
aatccttatgtacaagctcgaagccggattgatcaacttaagagattgggtcacagtgtt
gacaaggttgaatttatcttgatgggaggtacattcatgtcattgcctgctgaataccgt
gattacttcacacggaatctccatgatgctttatccggacatacttctgccaatgttgaa
gaggctgtcgcatactctgaacatggggcgacaaagtgcattgggatgacaattgaaacg
aggccagactactgccttggacctcatctgagacaaatgctttcttacggttgtacgcgg
ctagaaattggagtacagagtacgtatgaggatgttgctcgtgacaccaatagaggccac
actgttgcagctgtggctgattgcttttgtttggcaaaagatgctggcttcaaggtggtt
gctcatatgatgccggaccttccaaatgttggcgttgaaagagacttggagagtttcaag
gaattctttgaaagtccttcatttaggactgatggacttaaaatttatcctacacttgtt
attcgtggcacaggactctatgaactgtggaaaactggaaggtatagaaattatccgcca
gagcagcttgtagacattgtagcaaggattctttctatggtgccaccctggacccgagtt
taccgggtccaacgtgatatccctatgcctctagtgacttctggagttgagaaagggaat
ctccgagaactggctttagctcgaatggatgatcttggcttgaaatgccgagatgtccga
acacgcgaagctgggatccaggacattcacaacaagataaggcctgaagaggttgagctt
gttcgccgcgattatactgcaaatgaaggatgggagactttcctttcatatgaagataca
cgccaggatattcttgttggattgctacggctgcggaagtgtggacggaatgtgacttgc
ccagaacttacgggaaggtgttcaattgttcgtgagcttcatgtgtatgggactgcagtt
cctgttcatggtcgagacacagataagctgcagcaccagggttatggcactctgctgatg
gaggaggctgagcggattgctcggagggagcataggtcgaccaaaatcgctgttatatcg
ggtgtagggacccggcattactacagaaagctaggctatgagcttgaaggtccttacatg
gtaaaaaaccttgtgtag

DBGET integrated database retrieval system