KEGG   Solanum lycopersicum (tomato): 101246749Help
Entry
101246749         CDS       T02665                                 

Definition
histone acetyltransferase HAC1-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101246749
Transcription factors [BR:sly03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101246749
Mitochondrial biogenesis [BR:sly03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101246749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1709 aa AA seqDB search
MNLQHMSGQISGQVPNQSGTSLPGLPQQSGNPLTMQMQNPVVHSNVLNMEPDFSRARIFI
SNKIYDYLMQRQQSHEKPPKKVMDIVKRLEEGLFKSASSKEEYLNQATLENRLHVLIKSL
RMNNQNQRFPRVNSSGSIGTMIPTPGMTQSANSALIGTSSVDSSMAAGSTIASSAGSFLP
MANVSSRCLTNGYQQPTSNFLVSSGGNNLVPSMSGQRMTSQMIPTPGFNASGGANLNSNT
NTQSSLNLDSTNSIAALPSVDSMNVSQPLQQKQHVAAQNSRILHTVGSHVGGGIRSGFQN
RSYGQSTGPLNGGGLGMIGNNLHLVNGSAPEGYISATTYGNSPKSLPQHFDQQHQPLMQG
DRYGISHADTSGSGNLCLPVSSVGMVMNNQKPGAVALQSISRTNSPLITNQSNLTASGQM
PNHQHSQQPPQQFQEQHQLVQPQLQQKLQNQQHQTLSRSNAFAQAQAPSDIGIQVKSEHG
NHDEAQHSRVNAEQFQFSDMDQFQPNSIEDHSKGTQLLPPSSSHQDICFSVSQPSEQMFQ
LLNLQQFVTDSESRFSFFSNGVHSDAVFQGQWYSKSQDGSQIPGSFSDKQNVQEELYLRT
SRKEEAYPNNLCTERSPIGQPVGNGAVATNNASSSICRFNHLPRERQYFNQQKWLLFLTH
ARGCSAPEGKCAEKNCIKAQKLVKHMERCSTFECQYPRCPATRDLINHYRRCRDLNCPVC
IPVRKFVRAQQKVARPGCNSDMPSSANGTCRSYGTGEIASRLTAKQGSVPVQTEDLQYSV
KRPKIEQPSQSLIVETENCFMSVTASESHVTQNAQPIEQHGNAVAMKSEITDAMMEIPAK
AVLVSPRSIDIRNDNLDGSCIRKSDGDSVVSSNAACLVKQENVKTEKDIVQPKQENMSAP
SESTSGSKSGKPTIKGVSMTELFTPEQVREHIIGLRRWVGQTKAKAEKNQAMEHSMSENS
CQLCAVEKLNFEPPPIYCTPCGARIKRNAMYYTIGTGDTRHYFCIPCYNEARGDTINVDG
TTIPKARMEKKKNDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQAEYTCPNCYIIEV
ERGERKPLPQSAVLGAKDLPRTCLSDHIEVRLDRVLKDDRQKRAEREGKSYDEVPGAEGL
VVRVVSSVDKKLEVKSRFLEVFQEENYPLEFPYKSKVLLLFQKIEGVEVCLFGMYVQEFG
SECAQPNHRRVYLSYLDSVKYFRPEIKAASGEALRTYVYHEILIGYLEYCKKRGFSSCYI
WACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKAVKEKIVVDLTNLFDHFFTTTG
ECKAKITAARLPYFDGDYWPGAAEDMIFQLQQEEDGRKHHKKGAMKKTISKRALKASGQS
DLSGNATKDILLMHKLGETISPMKEDFIMVHLQHACTHCCILMVSGNRWVCKQCKNFQLC
DKCYEVEQKLEARERHPLYHKDIHMLYPTEIDDVPADTKDPDEILESEFFDTRQAFLSLC
QGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNICHLDIETGQGWRCETCPDYDVC
NACYQKDGGVDHPHKLTHHPSIAERDAQNKEARQQRVLQLRKMLDLLVHASQCRSSHCQY
PNCRKVKGLFRHGIQCKVRASGGCVLCKKMWYLLQLHARACKVSECHVPRCRDLKEHLRR
LQQQADSRRRAAVMEMMRQRAAEVANSAG
NT seq 5130 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcagcatatgtccgggcagatctcagggcaggttccaaatcaaagtggcact
tctctgcctgggctaccccagcagagtggaaatcctcttactatgcagatgcaaaatccg
gttgtccatagcaatgtgctaaatatggagcctgatttctcgagagctcggatttttata
tcaaataagatctacgattatctaatgcagcggcagcaatcccatgagaaacctccaaag
aaggttatggatatagttaaacgcttggaggagggcttgtttaaaagtgcttcatcaaag
gaagagtatttgaatcaagcaactttggagaaccggttacatgtcctgattaaaagcctc
cggatgaacaaccagaaccagcgattccctcgtgttaattcttctggctccattggtaca
atgataccaaccccaggcatgacacaaagtgcgaattcagccctgattggaacatcatct
gttgacagttccatggctgctggcagtaccattgcatcctctgcgggaagcttcttgcca
atggctaatgtgtcttccaggtgtttgacaaatggatatcaacagccaacttccaatttc
ttggtcagttcgggtgggaataatttggtaccatcaatgagtgggcaaagaatgacaagc
caaatgatccccactccagggtttaatgccagtggtggtgctaatttgaatagcaacact
aacacacagtcttccctgaatttggactcaaccaatagtattgctgcacttcctagtgtt
gattccatgaatgtttcacagcctctgcaacaaaagcagcatgttgctgctcaaaacagc
cgtatactccatacagttggcagccatgtgggtggtggaatcaggtcaggatttcagaat
agatcctatggacagtcaactgggcctcttaatggagggggacttggaatgattggaaac
aatttgcacttggtgaatggttcagcacctgagggctatatatcagcaaccacgtatggg
aactccccaaagtcattgccgcagcacttcgatcaacagcatcaaccattaatgcaaggt
gatagatatggtatcagtcatgcagatacttcggggtctggaaacttatgtcttcctgtt
tcttctgtgggaatggtcatgaataatcaaaaaccgggtgctgtagccttacagtccatc
tccagaacaaactctccgttgattaccaatcagtcaaacttgactgcctctgggcaaatg
ccaaatcatcaacattctcaacagccacctcagcagttccaggagcaacatcaacttgtt
caacctcaactccaacagaagctgcaaaatcagcagcaccaaactttgtcaaggagcaat
gcttttgctcaagctcaggctccttctgatattggtattcaggtaaagtctgagcatgga
aatcatgatgaagctcaacattcccgggtcaatgctgagcaatttcagttctctgacatg
gatcagtttcagccaaattctattgaagaccattctaaaggtactcagttgctccctcct
tcgtctagtcatcaggatatctgtttttcagtgtctcagccttcagaacaaatgtttcaa
ttgttgaatttacaacagtttgttactgactctgagagtcgtttcagctttttctctaat
ggggttcattcagatgcagtatttcagggtcaatggtattccaagtcgcaagatgggagt
caaataccgggtagcttctcagataagcaaaatgtgcaagaggagttgtatctgagaact
tccaggaaagaggaagcttatccaaataatttatgcactgagagatcaccgatcggtcaa
cctgttggtaatggagcagttgccaccaataacgcaagcagctccatctgcagatttaat
caccttcctcgtgaacgacagtatttcaatcagcagaagtggctattgtttttgactcat
gcacgtggatgttctgctcctgaagggaaatgtgcagagaagaattgcataaaagctcaa
aaacttgtgaagcatatggaacgatgcagcacctttgagtgtcaatatcctcgttgccct
gccacaagagacttaattaatcactatagacgttgcagagatctaaactgtcctgtttgc
attcctgtcaggaaatttgtacgggcacaacagaaagttgctcgtcctggctgcaattct
gatatgccatcttctgctaatggtacttgtagatcctatggtaccggtgagattgcttcc
aggttgactgccaagcagggttcagtgccagttcaaacagaagatttacagtattcagtt
aagcgcccgaagattgagcaaccttctcaatctcttatcgtggaaactgaaaattgtttt
atgtcagttaccgccagtgagtctcacgttacccaaaatgcccagcccattgaacagcat
ggcaatgctgtggcaatgaaatctgaaatcactgacgcaatgatggaaattcctgctaag
gctgtgctagtcagtcccaggagtattgacatacgaaatgacaatttggatggttcctgc
attcggaagtctgatggtgattctgttgtatcaagtaatgcagcttgtcttgtgaaacag
gaaaatgttaagactgaaaaggacattgttcagcctaaacaggaaaatatgtcagcaccc
tctgaaagcaccagtggatctaagtctgggaagcctacaataaagggtgtatcaatgact
gaattattcaccccagagcaagtccgagaacacattattggtctgaggcgatgggttggc
cagaccaaagcaaaagcagaaaaaaatcaagcaatggaacattccatgagtgaaaattca
tgtcaattatgtgcagttgagaagctaaattttgaacctccacctatatattgtactcct
tgtggtgctcgtattaaacgaaatgcaatgtattataccattggaactggtgatactaga
cactacttttgcattccatgctataatgaggctcgtggagacaccattaatgttgatggg
accactatcccgaaggcgaggatggagaaaaagaaaaacgacgaggagactgaagaatgg
tgggttcaatgtgataagtgtgaagcttggcaacatcagatttgtgcattgttcaatggt
aggaggaatgatggtgggcaagccgagtatacctgtcccaattgctatattatagaggtt
gaaagaggtgagcgtaagcccttaccacagagtgctgttcttggagccaaagatctgcct
cgcacatgtctcagtgatcatattgaggttcgattagatagggttttgaaggatgataga
caaaaaagagcagaacgtgaaggaaaaagttatgatgaggttcccggtgctgaagggctt
gttgtaagagttgtgtcatcagtagacaaaaagttagaagtgaaatcaaggtttcttgag
gtctttcaagaagagaactatccgctggagttcccatataaatcaaaggtgttattgtta
tttcagaaaattgagggtgtagaagtgtgcctctttggcatgtatgttcaggaatttgga
tctgaatgcgcacaaccaaatcatcgtcgtgtttatctctcgtatctagattctgtcaaa
tatttcaggcctgagatcaaagctgcatctggcgaggctcttcgcacttatgtgtaccat
gaaattttgattggatatttagaatattgcaaaaagcgtggtttctcaagttgctatata
tgggcttgtcctccactgaagggtgaagattatatattatattgccacccagaaatccag
aaaaccccaaaatctgacaaactcagagagtggtatttatcaatgttacgaaaagctgtg
aaggaaaagattgttgtggatctcacaaatttatttgaccatttcttcaccaccacaggc
gaatgtaaagctaaaatcactgcagctcgcctgccctattttgatggagactattggcct
ggtgcagcagaggatatgatttttcaacttcaacaagaagaagatgggaggaaacatcat
aagaagggggctatgaagaagaccatatcaaaaagagctcttaaagcatctggtcaatcc
gatctttctggaaatgcaactaaggatatacttctaatgcacaaacttggtgaaactatt
tctccaatgaaggaagattttattatggtccatttgcagcatgcatgtactcattgctgt
attctgatggtatccggtaatcgttgggtatgcaaacaatgcaagaactttcagctttgc
gacaagtgctatgaagttgagcaaaaactcgaagccagagaaaggcatcctctctatcac
aaggacattcatatgctttatccaactgaaattgatgatgtacctgctgatacaaaggat
ccagatgaaattcttgagagtgagttttttgatacaaggcaggcatttttgagcctttgt
caaggaaaccattaccaatatgataccctgcggcgtgctaaacattcctcaatgatggtc
ctttaccaccttcataatcccactgcaccagcttttgtgacaacttgcaatatttgtcat
cttgacatagaaacaggtcaaggttggcggtgtgaaacttgtcctgattatgatgtatgt
aatgcttgctatcagaaggatggtggagttgatcatcctcacaagttaactcatcaccca
tccattgctgagcgtgatgctcagaataaagaagctagacaacaacgagttctgcagctt
aggaagatgcttgacctcttggtgcatgcatctcagtgccgctcttcccattgtcaatat
ccaaactgtcggaaagttaaggggcttttccgccatggtatacagtgcaaagtacgtgct
tcaggaggttgtgttctctgtaagaaaatgtggtaccttcttcaactccatgcccgtgct
tgcaaagtatccgagtgtcatgtgccgcgatgcagagatttgaaagaacatcttcgaagg
ctgcaacagcaagctgattctcggcggcgggctgctgttatggagatgatgagacagcgt
gctgcagaggttgccaacagtgctgggtga

DBGET integrated database retrieval system