KEGG   Solanum lycopersicum (tomato): 101247796Help
Entry
101247796         CDS       T02665                                 

Definition
(RefSeq) probable pectinesterase/pectinesterase inhibitor 17
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00040  Pentose and glucuronate interconversions
sly01100  Metabolic pathways
Module
sly_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101247796
Enzymes [BR:sly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101247796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase PMEI Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 101247796
NCBI-ProteinID: XP_004234932
UniProt: K4BIG2
Position
3
AA seq 523 aa AA seqDB search
MAIKLSFFVLLISFSSFFFPILSINIFDSGINAWCNKTPYPDQCKYFMNHGSYHFAPKNK
IDFKKMAVKIALERALQAETYTKGLGVKCRNELERAAWSDCVKLYESTILQLNKTLDSNT
KCTDFDIQTWLSTAMTNLETCQTGFIELGVNSDYILPSLMSNNVSELICNTLALNNVDFV
SNRKQTYKDGFPSWVSPGDRKLLQLSSISPNLVVAQDGTGNFLTIKAALDAAAKRSGNER
FVIRVKRGVYRENLEIGNKMKNIMLVGDGMKYTIITGSRSVGGGSTTFNSGTVVVTGEGF
IAQGITFRNTAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTV
DFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPVV
GTFKTYLGRPWKQYSRTVIMKTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNNGPGASTS
SRVKWPGYRVITNSNEAARFSVENLIAGGSWLPATNVPFRAGL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcgataaagcttagtttctttgtgctacttatttccttttcatcattcttttttcct
attttatcgattaacattttcgatagtggcataaatgcttggtgcaacaaaaccccttat
cctgatcaatgcaagtatttcatgaaccatggttcgtaccattttgcacccaagaacaag
attgatttcaagaaaatggctgtgaaaatcgcgttggagagagcacttcaagctgagact
tacaccaaaggactaggtgtgaagtgtaggaatgaactcgaaagggcagcttggtccgat
tgtgtgaagctctatgagagtacaattctccagctcaataaaacactcgattccaatact
aaatgtactgattttgatatacaaacatggctaagtacagccatgacaaatcttgaaaca
tgtcaaactggattcattgagctaggcgttaattcagactacattttgcctagtcttatg
tccaataacgtgtctgaattaatttgtaacactttggcactcaacaatgttgactttgta
tccaataggaagcaaacgtataaagacggtttcccttcttgggtatctccaggcgataga
aaattgttacaattgtcctccataagtccaaatcttgtggtggctcaagatggtacaggg
aattttctcactattaaagcagctttagacgctgccgccaaaagaagtggaaatgaaagg
tttgttatacgtgtgaaacgaggagtttatagagaaaatttggagattggaaacaaaatg
aagaatattatgttggttggcgatggaatgaagtacacaattatcacaggcagccgtagc
gttggaggaggctctaccacgtttaactctggcaccgttgtggttactggagaaggattt
attgctcaaggcattacattccgcaatacagctggtccagaaaatcatcaagcagttgca
ctacgttctggatctgatctatccgttttctatcgttgtggatttgaagggtatcaggac
actctctatgtccattcacaacgacagttttataaagaatgttatatttatggtacagta
gactttatttttggtaatgctgcagtggttttgcaaaattgcatgatttttgctaggaga
cctatggataaacaaaagattaccataacagcacaaggccggactgatcctaaccagaac
actggaatttcaatacataactcgcgagttatggctgcatctgaccttaggcctgtggta
ggtacattcaagacatatttaggacgaccatggaaacaatattcgcgtactgttattatg
aaaacctatcttgattcattggtggatcctgctggttggctagagtgggatggtgatttt
gctttaaatacgttgtattacggcgaatacaggaataatggtcctggagcatcgactagt
agtagagttaagtggcctgggtatcgagtgatcacaaattcaaatgaagcagcaaggttc
agcgtggaaaatttaattgctggtggatcatggttgccagcaactaatgtgccatttcgt
gcaggtctctaa

DBGET integrated database retrieval system