KEGG   Solanum lycopersicum (tomato): 101249265Help
Entry
101249265         CDS       T02665                                 

Definition
chalcone--flavonone isomerase-like
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:sly00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 226 aa AA seqDB search
MAVVTKLQVENHVFPPTMVNPLGSNNMFFLAGAGNRGLEIEGKFVKFTAIGVYLEESAIP
FLADKWKGKSSEELEHSVEFFRDIVTGPFEKFTRVTMILPLTGKQYSEKVAENCVAYWKA
IGTYSDAEMQAIEKFLDVFQSETFPPGASILFTQSPLGSLTISFSEDDSVPCVGNAVIEN
KQLSEAVLDSIIGEHGVSPAAKCSIAKRVSELLVCEKPGSELSSVQ
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgttacaaaattgcaggtagagaatcacgtgttcccaccaacaatggtgaat
cctctgggctccaacaatatgttttttctcgccggcgcagggaatagaggtttggagatt
gaaggaaaatttgtgaagtttactgcgatcggtgtgtacttggaagagagtgctattcca
tttctagctgataaatggaaagggaaaagctctgaggagttggaacattcagtcgaattc
ttcagggatatcgttacaggtccatttgagaaattcactcgagtgactatgatcttgccc
ttgacgggtaagcaatactctgagaaggtagcagaaaattgtgttgcatattggaaagca
ataggaacctacagtgatgcagagatgcaggccattgagaagttcctcgatgttttccag
agtgaaaccttcccacctggtgcctccatcctttttactcaatcaccgcttggatcattg
acaattagcttctctgaagatgattcagttccttgtgttgggaatgctgttatagagaac
aaacaattgtcagaagcagtgctggattccataattggcgagcacggagtttcccctgca
gcaaagtgtagtattgcaaaaagagtatcagaactgttggtttgtgaaaaaccaggaagt
gagctatcgtcagtccagtaa

DBGET integrated database retrieval system