KEGG   Solanum lycopersicum (tomato): 101249374Help
Entry
101249374         CDS       T02665                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101249374
Peptidases [BR:sly01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101249374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 232 aa AA seqDB search
MAESTGSKKRWLPLEANPDVMNQFLWGLGVPPNEAECCDVYGLDEELLEMVPKPVLAVLF
LYPLTSQSEEERMKQDNETKVQDPSSTVYYMKQTVGNACGTIGLLHAIGNITSQIKLTEG
SFLDKFFKSTSSMDPMQRALFLENDREMEVAHSVAATAGDTEATDDVNTHFICFSCVDGQ
LYELDGRRAGPITHGASSPNSLLKDAATVIKKIIEQNPDSINFNVIAISKNV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaagcacaggctctaagaagagatggcttcctcttgaagctaacccggatgtc
atgaatcagtttctttggggtcttggtgttccaccgaatgaggcagagtgctgtgatgtt
tatgggttagatgaagaacttctggagatggtgccaaagccagtgcttgctgttttattt
ctttatcctctcacatcgcagagtgaagaagagagaatgaagcaagataatgaaacaaag
gtgcaggatcccagtagtacagtttactacatgaaacaaacagtgggaaatgcatgtgga
acaattggtcttcttcacgctattgggaatatcacctctcagataaaacttaccgagggt
tcattcttggacaagttctttaaatcaacttcaagcatggacccaatgcagcgtgctttg
ttccttgaaaacgatagggaaatggaagttgctcattcagtggcagccactgctggtgat
actgaggctaccgacgatgtgaacactcatttcatctgcttctcctgtgttgatggacaa
ctctatgaacttgatgggaggagggcaggacctattacacatggtgcatcctctccaaac
agcttattaaaggatgcagccacagttatcaaaaagataatcgagcaaaatccagactca
atcaactttaacgtcattgctatttcgaaaaacgtttag

DBGET integrated database retrieval system