KEGG   Solanum lycopersicum (tomato): 101249374Help
Entry
101249374         CDS       T02665                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
sly  Solanum lycopersicum (tomato)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 232 aa AA seqDB search
MAESTGSKKRWLPLEANPDVMNQFLWGLGVPPNEAECCDVYGLDEELLEMVPKPVLAVLF
LYPLTSQSEEERMKQDNETKVQDPSSTVYYMKQTVGNACGTIGLLHAIGNITSQIKLTEG
SFLDKFFKSTSSMDPMQRALFLENDREMEVAHSVAATAGDTEATDDVNTHFICFSCVDGQ
LYELDGRRAGPITHGASSPNSLLKDAATVIKKIIEQNPDSINFNVIAISKNV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaagcacaggctctaagaagagatggcttcctcttgaagctaacccggatgtc
atgaatcagtttctttggggtcttggtgttccaccgaatgaggcagagtgctgtgatgtt
tatgggttagatgaagaacttctggagatggtgccaaagccagtgcttgctgttttattt
ctttatcctctcacatcgcagagtgaagaagagagaatgaagcaagataatgaaacaaag
gtgcaggatcccagtagtacagtttactacatgaaacaaacagtgggaaatgcatgtgga
acaattggtcttcttcacgctattgggaatatcacctctcagataaaacttaccgagggt
tcattcttggacaagttctttaaatcaacttcaagcatggacccaatgcagcgtgctttg
ttccttgaaaacgatagggaaatggaagttgctcattcagtggcagccactgctggtgat
actgaggctaccgacgatgtgaacactcatttcatctgcttctcctgtgttgatggacaa
ctctatgaacttgatgggaggagggcaggacctattacacatggtgcatcctctccaaac
agcttattaaaggatgcagccacagttatcaaaaagataatcgagcaaaatccagactca
atcaactttaacgtcattgctatttcgaaaaacgtttag

DBGET integrated database retrieval system