KEGG   Solanum lycopersicum (tomato): 101250204Help
Entry
101250204         CDS       T02665                                 

Definition
(RefSeq) (R)-mandelonitrile lyase-like
  KO
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Cyanoamino acid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    101250204
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     101250204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 540 aa AA seqDB search
MPKFFLFFTIIILITHSDSSNESPSYMGFVFNATEFPSEDYYDYIVVGGGTAGCPLAATL
SEKYRVLLLERGGVPYGRPNLMTQEGFLTVITDVDDFESPAQAFVSEEGVPNARGRILGG
SSAINAGFYSRADQDFYARSKLNWDLQVVNQSYEWVEKAIVFRPELKNWQSAVRDGLVES
GIHPFNGFTLDHVIGTKIGGSTFDTSGRRYSAADLLNFANPSNIHVAVYASVERILLAPS
ADYSPSKQAATGVVFSDQSGRYHHAMLRGKGEVLVCAGALGSPQLLLLSGVGARPYLSTW
GIPVAHHLPYVGRFLFDNPRNGISIVPPMALEHSLIQVVGITNSGAYLEAASNVIPFASP
ASSLFLRTSPSPVYVTVATLMEKIVGPVSSGSLRLASTDVKLNPIVRFNYFSNPEDVERC
VNGTRKIAQVLRSRTMDIFKFDEWFGSRDFRYVGPALPVDESNDELLKDFCHETVSTIWH
YHGGCVVGKVVDENLRVLGIDGLRVVDGSIFRVSPGTNPQATLLMLGRYVGTVMLRERFR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaatttttcctcttcttcaccattatcatactgattacgcactctgattcttct
aacgaaagtccaagttatatggggtttgtgttcaacgccacggagttcccatcggaagac
tattacgattacatcgttgtgggaggtggcaccgccggttgtccactggcggcgacattg
tccgagaagtaccgagttttactccttgaaagaggcggtgttccatatggaaggcctaat
ttgatgacccaagaaggctttctcactgtaattacagatgttgatgattttgagtcccct
gcacaagccttcgtctccgaagagggagttccaaatgccagaggtcgcattcttggggga
agtagtgcaattaatgccggtttttacagtagggctgatcaagatttctacgctaggtcg
aaattgaattgggatttgcaagttgtaaatcaatcttatgaatgggttgagaaggctatt
gtgtttaggccggaactcaagaattggcagtcggctgtcagggatggattagtggagtcc
ggcattcatcctttcaatgggttcactctggatcatgttattggtaccaagattggtggc
tccacctttgatacctctggccgcagatatagtgctgctgatcttctcaattttgcaaat
ccttcaaacattcacgtagccgtttatgcaagtgtcgagagaattctgctagctccatcc
gcagattattctccatctaagcaggctgctactggtgtggtttttagtgaccaatctggg
cgctatcaccacgccatgcttcgtggaaaaggtgaagttttagtatgtgcaggagctctt
ggtagcccacagttgcttctgttgagtggtgttggtgcaaggccttacctatctacatgg
ggtataccagttgctcaccatttaccttatgtggggaggtttctgtttgataatccaaga
aatggtatctccattgtgccacccatggcactcgaacactctttgattcaagttgtgggg
atcactaattcgggggcttacttggaggctgcctctaatgtcattccatttgcttcccct
gctagctccctttttctcagaacttccccgtctccagtttatgttacagtggcgaccctc
atggagaagatagttggacctgtttcttctggttcgcttcgattggcatccaccgatgtt
aaactgaaccctattgttcgattcaattacttcagcaaccctgaagatgtagagaggtgt
gtgaatggtacccggaaaatagcacaagttctgagaagtagaaccatggatattttcaag
tttgatgagtggtttggcagtagggattttcggtatgttggtcctgctttgcctgttgat
gagtccaatgatgaactcctgaaggatttctgccatgagacagtgagtacgatttggcac
tatcatggtgggtgtgttgttgggaaggtagttgatgaaaatttgagagtgcttggcatt
gatgggctgagagttgttgatggttccatattcagagtgtcaccagggaccaatccccag
gctactcttctcatgcttggacggtatgttggtacggtgatgctcagggagaggtttaga
tag

DBGET integrated database retrieval system