KEGG   Solanum lycopersicum (tomato): 101250983Help
Entry
101250983         CDS       T02665                                 

Definition
4-alpha-glucanotransferase, chloroplastic/amyloplastic-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101250983
Enzymes [BR:sly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     101250983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 572 aa AA seqDB search
MAIHTCFTLIPSSLSSPKLPFPKNTIFPKLSKPTFMFDRKSSFQNGTAAVPAVGEDFPID
YANWLPKRDPNDRRRAGILLHPTSFPGPYGIGDLGPEAFKFLDWLHLAGCSLWQVLPLVP
PGKRGNEDGSPYSGQDANCGNTLLISLEELVDDGLLKKEELPEPLPTDRVNYSTISEIKD
PLITKAAKRLLSSEGELKDQLEKFRRDPNISSWLEDAAYFAAIDNSVNTISWYDWPEPLK
NRHLGALEEVYQREKDFIDIFIAQQFLFQRQWKKVRDYARSKGISIMGDMPIYVGYHSAD
VWANKKQFLLNRKGFPLIVSGVPPDAFSETGQLWGSPLYDWKAMEKDGFSWWVRRIQRAM
DLFDEFRIDHFRGFAGFWAVPSEEKIAILGRWKVGPGKPLFDAILQAVGKINIIAEDLGV
ITEDVVQLRKSIEAPGMAVLQFAFGSDAENPHLPHNHEQNQVVYTGTHDNDTIRGWWDNL
PQEEKSNVLKYLSNIEEEDISWGLIEGAVSSVARIAIIPMQDVLGLGSDSRMNIPATQFG
NWSWRIPSSTSFDSLDAEAKKLRDILATYGRL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcacacttgtttcacactaataccttcttctttatcttctcccaaattgcca
tttcccaaaaacactatcttcccaaaattatcaaaacccactttcatgtttgatcggaaa
agttcctttcaaaatggcaccgctgctgttcctgctgtaggcgaggattttccgattgat
tatgctaattggctgccaaaacgagacccaaacgatcgtagaagagcgggaattttgctt
catcctacctcgtttcctggaccttatggtattggtgacctaggccccgaagcttttaag
ttccttgattggcttcatcttgctggttgctccctttggcaggttcttccacttgtaccg
cctggaaagagaggcaatgaagatggatcaccctattcaggacaggatgcaaattgtggt
aacacacttctgatttctcttgaagagcttgttgatgatggtttactgaagaaggaggag
cttccggagccactacctacagatcgtgtcaattactcgactatatctgagataaaagat
cctttaataaccaaggcagcaaagaggcttctctccagtgaaggggaactgaaagaccag
cttgagaaatttcgtcgggatccaaatatttcgagttggctggaggatgctgcttatttt
gctgccatagacaactctgtaaacactattagctggtatgattggcctgaaccattgaaa
aatcgccatcttggagctctagaagaagtttatcaacgtgaaaaggattttattgacata
ttcattgcacaacagttcttgttccaacgacaatggaaaaaagttcgtgactatgcacga
tccaaagggatcagtataatgggagacatgccaatatatgttggatatcacagtgctgat
gtttgggccaacaagaaacaatttttgctgaataggaaaggtttccctcttatagttagt
ggtgttcctccagacgcctttagtgaaactggtcaactatggggcagccctctctatgat
tggaaagccatggagaaggatggattttcatggtgggtacgccgaattcaacgtgcaatg
gatctttttgatgaatttaggatagatcactttagaggatttgctggattttgggctgtt
ccctctgaggaaaaaattgcaattctgggacggtggaaggtgggacctggaaaacctttg
tttgatgctatcttacaagctgttgggaagatcaatattatagcagaagacttgggagta
attaccgaggacgttgttcagctaagaaagtccattgaggcacctggaatggctgtactc
cagtttgcatttggcagtgatgctgaaaaccctcatttgcctcacaatcatgagcagaac
caagtagtgtatactggaacgcatgacaatgatacaatccgaggttggtgggataatttg
ccacaggaagagaaatccaatgtactaaagtatttatcaaatattgaggaagaggatata
tcatggggcttgatcgaaggtgcagtttcttctgtagcccgtattgcaattataccgatg
caggatgttcttgggcttgggagtgattccagaatgaacattccagcaactcagtttgga
aactggagttggaggatacctagttcaactagctttgacagcctggatgcagaagcaaaa
aagctaagagatatacttgcaacttatgggcggttgtga

DBGET integrated database retrieval system