KEGG   Solanum lycopersicum (tomato): 101251203Help
Entry
101251203         CDS       T02665                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101251203
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101251203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 395 aa AA seqDB search
MTQTPKQNFEEEKRDTVENMKGLATPLQSKYWHPTAQNNLKNPESFNLYSHPVQFNGKNN
NPISRKVKPISCFASENQNQPILKESKPPLVVVGSANADIYVEIDRLPKEGETISAKTGQ
TLAGGKGANQAVCGGKLDYPTFFIGQVGEDAHGRLITEALESGGVCVDHLTTVANAPTGN
AVVMLQSDGENSIIIVGGANMSCWPEELSYEDLEIVRSAGIVLLQREIPDFVNIQVAKAA
RNAGVPVILDAGGADSPIPLELLRCVEIFSPNETELARITKMPTGNFEQISNAVEQCYDM
GVNQVLVKLGANGSALFTKGEEPLRQPIIKAAKVIDTTGAGDTFTAAFAVALVEGKSKEE
CLRFAAAAASLCVQVKGAIPSMPEKRAVFNLLQSA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacgccaaagcaaaattttgaagaagaaaagagggatactgtagaaaacatg
aaaggtctagcaacacctttacaatcaaaatactggcacccaacagcccaaaacaacctc
aaaaacccagaaagtttcaatctttacagtcacccagttcaatttaatggcaaaaacaac
aaccccatatcaagaaaagtgaaacccatctcttgttttgcttcagagaaccaaaatcag
ccaatcttgaaagaatcaaagcctccattggttgtagttggatcagctaatgcagatatc
tatgtggagattgataggttaccaaaagaaggggaaacaatttcagctaaaacaggtcaa
acattggctggtggaaagggggctaatcaagctgtttgtggtggaaagcttgattatcca
actttttttattggtcaagttggtgaagatgctcatgggagattgattactgaagcttta
gagagtggtggggtttgtgtggatcaccttactactgttgctaatgctccaactggaaat
gctgtggtgatgcttcagtctgatggggagaattcaattattattgttggtggtgcaaac
atgtcttgctggcctgaagaattgtcatatgaggatttggagattgtgagaagtgcaggg
attgtgttgctccaaagggaaattccagattttgttaacatccaagttgcaaaggctgcc
aggaatgcaggtgttccagttattctagatgctggtggagcagactctccaatccctcta
gaacttcttcgttgtgttgagattttcagcccgaatgaaactgagctggctagaataaca
aaaatgccaactggaaatttcgaacaaatcagcaatgcagtggaacagtgctatgacatg
ggagttaaccaggtccttgttaagcttggggccaatggatctgctcttttcaccaaagga
gaggaacccttgcggcaacccattattaaagctgcaaaagtcattgatacaacaggagct
ggtgacacttttacagctgcttttgcagtggccctagtggagggtaaatctaaagaggaa
tgtttgagatttgctgctgcagccgcttctctatgtgttcaagtgaaaggagccattcca
agcatgcctgaaaagagagcagtgttcaatcttcttcagtcagcttga

DBGET integrated database retrieval system