KEGG   Solanum lycopersicum (tomato): 101251358Help
Entry
101251358         CDS       T02665                                 

Definition
protoporphyrinogen oxidase, mitochondrial-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101251358
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101251358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 501 aa AA seqDB search
MAPSAGEDKQKRVAVIGAGVSGLAAAYKLKVHGLNVTVFEAEGRAGGKLRSLSQDGLIWD
EGANTMTESEGDVTFLLDSLGLREKQQFPLSQNKRYIARNGTPTLIPSNPFDLFKSNFLS
TGSKLQMLFEPLLWKNKKLTKVSDKHESVSGFFQRHFGKEVVDYLIDPFVAGTCGGDPDS
LSMHLSFPDLWNLEKRFGSVIVGAIQSKLSPIKEKKQGPPRTSINKKRQRGSFSFLGGMQ
TLTDAICKNLKEDELRLNSRVLELSCSCSGDSAIDSWSIFSASPHKRQAEEESFDAVIMT
APLCDVKSMKIAKRGNPFLLNFIPEVDYVPLSVVITTFKKESVKHPLEGFGVLVPSQEQK
HGLKTLGTLFSSMMFPDRAPNNVYLYTTFVGGSRNRELAKASRTELKEIVTSDLKQLLGA
EGEPTYVNHLCWSKAFPLYGHNYDSVLDAIDKMEKSLPGLFYAGNHKGGLSVGKALSSGC
NAADLVISYLEAVSADTKNHS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctccatctgccggagaagataaacaaaagagagttgcagtcattggtgctggcgtc
agtggacttgctgcagcatacaagttgaaagttcatggcttgaatgtcacagtatttgaa
gcagaagggagagctggagggaagttacgaagcctgagtcaagatggcctaatatgggat
gaaggcgcaaatactatgactgaaagtgaaggtgatgtcacatttttgcttgattcgctt
ggactccgagaaaaacaacaattcccactttcacagaacaagcgctacattgccagaaat
ggtactcctactctgataccttcaaatccatttgacctattcaaaagcaattttctttcc
actggatcaaagcttcagatgcttttcgagccacttttgtggaagaataaaaagcttaca
aaggtgtctgacaaacacgaaagtgtcagtggattcttccagcgtcattttggaaaggag
gttgtcgactatctaattgacccttttgttgctggaacatgtggtggtgatcctgattcg
ctttcaatgcacctttcatttccagacttgtggaatttagagaaaaggtttggttcagtc
atagttggggcaattcaatctaagttatctcctataaaggaaaagaaacaagggccaccc
agaacttcaataaataagaagcgccagcgggggtccttttcatttttgggcggaatgcaa
acacttactgacgcaatatgcaaaaatctcaaagaagatgaacttaggctaaactctaga
gttctggaattatcttgtagctgtagtggggactctgcgatagatagctggtcaattttt
tctgcctctccacacaagcggcaagcagaagaagaatcatttgatgctgtaattatgacg
gcccctctctgtgacgttaagagtatgaagattgctaagagaggaaatccatttctgctc
aactttattcctgaggtcgattatgtaccactatctgttgttataaccacatttaagaag
gagagtgtaaagcatccccttgagggttttggagtgcttgtaccctcccaggagcaaaaa
catggtctgaagacactaggcaccctcttctcttctatgatgtttccagatcgtgcaccc
aacaatgtctatctctatactacatttgttggtggaagccgaaatagagaactcgcgaaa
gcctcgaggactgagctgaaagagatagtaacttctgaccttaagcagttgttgggtgct
gagggagagccaacatatgtgaatcatttatgctggagtaaagcatttccattgtacggg
cataactatgattcagtcctagacgcaattgacaaaatggagaaaagccttcctggatta
ttctatgcaggtaaccacaaggggggattgtcagttggcaaagcattatcttctggatgc
aatgcagcagatcttgttatatcatatcttgaagcggtttcagctgacaccaaaaaccat
agctga

DBGET integrated database retrieval system