KEGG   Solanum lycopersicum (tomato): 101252596Help
Entry
101252596         CDS       T02665                                 

Definition
(RefSeq) protein disulfide isomerase-like 5-2
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sly00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101252596
Enzymes [BR:sly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101252596
Chaperones and folding catalysts [BR:sly03110]
 Protein folding catalysts
  Protein disulfide isomerase
   101252596
Membrane trafficking [BR:sly04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101252596
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101252596
  Exosomal proteins of colorectal cancer cells
   101252596
  Exosomal proteins of bladder cancer cells
   101252596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Calsequestrin Thioredoxin_8 ERp29_N Thioredoxin_7 Thioredoxin_9
Motif
Other DBs
NCBI-GeneID: 101252596
NCBI-ProteinID: XP_004241830
UniProt: K4C7G1
Position
6
AA seq 442 aa AA seqDB search
MMKNMSFVILLLVLVSRPFITAAESEQQKQQLGIDSGKVLELDESNFDAAISSFDYILVD
FYAPWCGHCKRLAPQLDKAASILADLKKPISIAKIDADKYKRVGSKYGIDGYPTLKIFMH
GVPTEYYGPRKADLLVRFLKKFVAADVAILNSDSAISEFVEAAGTSFPIFIGFGLNESAI
SHFAVKYKKRAWFSVAKDFSDKTMEFYDFDKVPALVARHPNYDEQSIFYGPFEENFVEDY
IKQSLLPLTLPITEETLRLLKDDERKVILTILEDETDDRSKKLLKLLKAAASANRDFVFV
FVGFKQWQGFAESFDVSKKTKLPKMVVWDGDEEYFSVVGSESVEDEDQGSQITHFIQGYK
DGNIIQKRISSGSFMGFINSMIGLGTVTIIVFVVAVVMIIQSLKEEPLTVGTRDEGDHPS
SSTSQTEARQPLRSGEKQDKED
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaatatgtcttttgtcatcctcctcttagttttggtttcacggccgttcatc
acggcggcggagtcggaacagcagaagcaacagttgggcatagacagcggtaaagtattg
gaacttgatgaatctaactttgatgctgcaatttccagttttgattatattttggtcgat
ttctacgctccttggtgtggtcactgcaaacgacttgcacctcagttggacaaagctgct
agcatacttgctgatttgaagaagcccataagtattgcaaaaatagatgctgacaagtac
aaacgtgttggttcaaaatatggcattgatggatatccaactttaaagatatttatgcat
ggtgttccaacagaatattatggaccaagaaaagcagatttacttgtacgattcttgaag
aagtttgttgctgctgatgtggccatactcaattctgattcagccattagtgaatttgtt
gaagcagccggcactagtttccctatatttataggctttggtttgaatgaatctgccata
tcacattttgcagtaaaatacaagaagagagcatggttttctgtggcaaaagatttctcg
gataagaccatggaattctatgattttgacaaggtacctgctttggtagctcgtcatcca
aactatgatgaacaaagcatcttctatggcccctttgaagaaaattttgttgaggattat
atcaagcagagtttgctcccactgactttgcccattactgaagaaactctgagattgctg
aaagatgatgagagaaaagttattctaacaattttggaagatgaaactgatgataggtct
aagaaattattgaagctcctgaaagctgctgcatctgcaaaccgcgacttcgtgtttgtt
tttgttgggttcaagcaatggcaagggtttgctgaatcatttgacgtttctaagaaaact
aagctgccaaaaatggttgtttgggatggcgatgaggagtacttttcagttgttggctct
gagagcgttgaagatgaagatcaggggtcccaaattacacattttattcaaggatacaaa
gacggaaatatcatacagaaacgtattagctctggttctttcatgggtttcataaactca
atgataggtttgggaacagtgaccatcatagtgtttgtggttgcggtggtgatgattatc
cagtctttgaaagaggaacccttaactgttggtacaagggacgagggagatcatccaagc
agctccacctctcagacagaagccagacaaccacttcgttctggagagaaacaagacaag
gaagattaa

DBGET integrated database retrieval system