KEGG   Solanum lycopersicum (tomato): 101253033Help
Entry
101253033         CDS       T02665                                 

Definition
histone acetyltransferase GCN5-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101253033
Transcription machinery [BR:sly03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101253033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 542 aa AA seqDB search
MDASHLTAPGRSRSSQSPSPSHSASASATSSIHKRKMASDDHAPPFPSSFSDTRDGALTS
NDDLESISARGGGADSDSEDDSEEVGDDDEEDYDASSIRNFTASRLETSVAMVPSGRNTK
IKSDNSVKIESSEIAKEVGTGCSGNVAPPTATGSVSGAVVKDESMKNIFTENLQTSGAYT
AREESLKREEESGRLKFVCVSNDGVDEHMIWLVGLKNIFARQLPNMPKEYIVRLVMDRNH
KSVMVIRRNLVVGGITYRPYTSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGL
THFLTYADNNAVGYFVKQGFTKEIYLEKERWQGYIKDYDGGILMECKIDPKLPYTDLSTM
IRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGIPKKAIKVEDIPGLREAGWTPDQYGHS
RFKTVNSLSDQKSLTAFMRSLLKIMHDHPDSWPFKEPVDARDVPDYYDIIKDPIDLKTMS
KRVESELYYVTFDMFLADVRRMFANARTYNSPETIYYKCSTRLESHFSNKVQAGLQSSIK
IQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggacgcttcgcacttgacggcgccgggccgatcccggagttcacaatcgccgtcaccc
tcacattctgcgtcggcctcagcgacctcatcgatccacaaacgcaagatggcatctgat
gaccacgcgccgcctttcccgtcctctttctccgacacgcgcgacggcgctcttacctcc
aacgatgacttagagagtatcagcgcccgcggaggcggtgcagattccgactccgaagat
gactccgaagaggtcggcgatgatgacgaagaagattatgatgcttcttccattcgcaat
ttcactgcctcgcgtttggagactagcgtggctatggtaccttcagggaggaacactaag
attaagagtgataattcagtgaaaattgagtcttccgagatagcaaaagaagttggtact
ggttgttccggtaatgttgcaccacctactgccactggttctgtttcaggggcggtagtg
aaggatgagagtatgaagaatatttttactgaaaatttacagactagcggtgcttataca
gcaagggaagagagcttaaagagggaggaggaatcaggaagactcaagtttgtatgtgtt
tcaaacgatggagttgatgagcatatgatttggttagtaggattgaagaatatattcgca
aggcaactaccaaacatgcctaaggaatatattgttcgtcttgtgatggacagaaaccat
aagtctgtaatggtcatcagacgcaatctggtggttggtggcataacatatcgtccatat
accagccagaagtttggggagatagctttttgtgcaattacagcagatgaacaagttaag
ggctatggcaccagattgatgaatcacttgaagcagcatgcacgcgatgtggatgggctg
actcattttctaacatatgctgacaacaatgctgttggttactttgtcaaacagggattc
acaaaagagatttatttagagaaagagcgttggcaagggtatattaaagattatgatggt
ggaatccttatggaatgcaaaatagatccaaagcttccatacacagatttatctacaatg
atacgtcgtcaaaggcaggcaattgatgaaaagataagggagctatcaaattgtcatatt
gtctaccctggaattgattttcaaaagaaggaagctggcattcccaaaaaggctatcaag
gttgaggatatccctggcttgagagaggctggatggactcctgatcaatatggtcattct
cgtttcaaaacagtaaactccttgtcagatcagaagtctttgactgcattcatgcgctca
ctcctgaaaataatgcatgaccatcccgattcctggcctttcaaagaacccgttgatgca
cgggatgttcctgattattatgacatcatcaaagatccaatagatttaaaaacaatgtca
aagcgggttgagtcggagttatattatgtgacatttgatatgtttttggcggatgtgaga
aggatgtttgcgaacgctcgcacctataactctcctgagaccatttactacaaatgttca
accaggcttgaatcacatttctcaaacaaagttcaagctggtctacagtctagcatcaag
attcagtag

DBGET integrated database retrieval system