KEGG   Solanum lycopersicum (tomato): 101255051Help
Entry
101255051         CDS       T02665                                 

Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 1-like
Organism
sly  Solanum lycopersicum (tomato)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 263 aa AA seqDB search
MAQIFREILFQEPNSIFIKVMIMINLIFSAILGYSEGSGKQNLEYSKFWNLKSQEKIKIP
SKIGMIIAYTPSLITCLSFFWIFPNSGIRFFMLNFAITIHFFKRLLEVLFVHKYSGSMAM
KSAITISSSYFIAFSSIIYIQHLTKGSIEPIIDLKYSGFIVFLVGIIGNFYHHFILSKIR
KKSESGYKIPKGGLFNLVICPHYFFEIVTFFGFSLISQTLFSFSSTIGTLFYLMGRSYAT
RKWYISKFEDFPRNVKALIPFVF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaatatttagagaaatattatttcaagaaccaaattcaatctttatcaaagtt
atgataatgataaatttaatattttcagcaatattgggttattcagaaggctcaggcaaa
caaaatcttgaatattcaaagttttggaatttgaaatctcaagaaaaaattaaaatccca
agcaaaattgggatgattattgcttatactcctagtttaattacatgtttaagcttcttt
tggatatttccaaatagcggaatcagatttttcatgcttaatttcgctattaccattcat
tttttcaaaagactccttgaggttttgtttgtgcacaaatatagtggttccatggctatg
aaatctgcaattactatttcctcaagctattttatagccttttcaagcataatatatatt
caacacttgaccaaaggatcaatagagccaataattgacttgaagtattctggatttatt
gtatttttagtgggaattattggcaatttttatcaccattttatcctttctaaaataaga
aaaaaaagtgaaagtggatataaaattcctaaaggtggcctttttaacttagttatatgt
ccacattacttctttgaaattgtcacattttttggtttttctcttattagccaaactttg
ttttcattttcttctaccatagggacattattttatttgatgggaaggagttatgctact
aggaaatggtacatttccaaatttgaagattttcctagaaatgttaaggctttaatacct
tttgtattttaa

DBGET integrated database retrieval system