KEGG   Solanum lycopersicum (tomato): 101255051Help
Entry
101255051         CDS       T02665                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 1-like
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101255051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 263 aa AA seqDB search
MAQIFREILFQEPNSIFIKVMIMINLIFSAILGYSEGSGKQNLEYSKFWNLKSQEKIKIP
SKIGMIIAYTPSLITCLSFFWIFPNSGIRFFMLNFAITIHFFKRLLEVLFVHKYSGSMAM
KSAITISSSYFIAFSSIIYIQHLTKGSIEPIIDLKYSGFIVFLVGIIGNFYHHFILSKIR
KKSESGYKIPKGGLFNLVICPHYFFEIVTFFGFSLISQTLFSFSSTIGTLFYLMGRSYAT
RKWYISKFEDFPRNVKALIPFVF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaatatttagagaaatattatttcaagaaccaaattcaatctttatcaaagtt
atgataatgataaatttaatattttcagcaatattgggttattcagaaggctcaggcaaa
caaaatcttgaatattcaaagttttggaatttgaaatctcaagaaaaaattaaaatccca
agcaaaattgggatgattattgcttatactcctagtttaattacatgtttaagcttcttt
tggatatttccaaatagcggaatcagatttttcatgcttaatttcgctattaccattcat
tttttcaaaagactccttgaggttttgtttgtgcacaaatatagtggttccatggctatg
aaatctgcaattactatttcctcaagctattttatagccttttcaagcataatatatatt
caacacttgaccaaaggatcaatagagccaataattgacttgaagtattctggatttatt
gtatttttagtgggaattattggcaatttttatcaccattttatcctttctaaaataaga
aaaaaaagtgaaagtggatataaaattcctaaaggtggcctttttaacttagttatatgt
ccacattacttctttgaaattgtcacattttttggtttttctcttattagccaaactttg
ttttcattttcttctaccatagggacattattttatttgatgggaaggagttatgctact
aggaaatggtacatttccaaatttgaagattttcctagaaatgttaaggctttaatacct
tttgtattttaa

DBGET integrated database retrieval system