KEGG   Solanum lycopersicum (tomato): 101256999Help
Entry
101256999         CDS       T02665                                 

Definition
steroid 5-alpha-reductase DET2-like
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    101256999
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101256999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 259 aa AA seqDB search
MFSDQNLYHYSLLSLFLIGPPTFIACQFLTAPYGKHRRSGWGPTISPPLAWFLMESPTLW
LTLILFPFGKNHNNPLSLILISPYLFHYTNRTIIYPLKLYFNSKGGSPASGFPVSIAFLA
FVFNLLNAYVQARWVSHYADYDSDVWFWVRFAGGMVVFAGGMAVNVWADKVLVGLKSEGN
GYKIPRGGLFEYVSCPNYLGEIVEWLGWALMTGSWAGFGFFLYTFANLVPRARFNHEWYL
QKFGEDYPRKRKAVIPFLY
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgttttcagatcaaaacttgtatcactacagcctcctctctctcttcctcatcggacca
cccaccttcatcgcctgtcaattcctcaccgccccttatggaaaacaccgtcgctccggt
tggggacctaccatttcaccacctttagcttggtttctaatggaaagccctactctgtgg
ctcacacttatcctcttccctttcggcaaaaatcacaacaatccattatcacttatcctc
atttctccttaccttttccactacacaaatcggacgataatttaccctttaaaactctac
ttcaactcaaagggtggatctccggcgagtggtttcccggtgagtattgcgtttttggct
tttgtgtttaatctgttgaatgcttatgtacaagctaggtgggtttctcattacgctgat
tacgattctgatgtgtggttttgggttcgatttgccggcgggatggtggtttttgccggc
gggatggcggtgaatgtttgggccgataaggtgttagtgggcctgaagagtgaaggaaat
ggatataagataccgagaggtgggctttttgaatatgtgagttgtccaaattacttgggg
gagatagtggagtggttgggctgggctttaatgactgggtcttgggccgggtttgggttt
tttctgtatacttttgctaatttggttcctagagctaggtttaatcatgaatggtatttg
cagaaatttggagaagattatccaaggaaaagaaaagctgttattccatttttgtattga

DBGET integrated database retrieval system