KEGG   Solanum lycopersicum (tomato): 101257133Help
Entry
101257133         CDS       T02665                                 

Definition
probable MYST-like histone acetyltransferase 1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101257133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 447 aa AA seqDB search
MGSIDTSTRAESGSDPIPTPNGTTNGLHAGEDSVQTPAVDSTGASAENESLRKRRGSGVL
PLEVGTRVMCRWRDGKYHPVKVIERRKFPCGGVNDYEYYVHYTEFNRRLDEWVKLEQLDL
NSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIE
LGRYEIETWYFSPFPPEYNDCSKLFFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRS
GTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFS
KEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGMLSYRG
YWTRVLLDILKKHKGNISIKELSDMTAIKAEDILSTLQGLELIQYRKGQHVICADPKVLD
RHLKAAGRGGLEVDVSKLIWTPYKEQN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgatagacacgtcaacgagggcagaaagcgggtcggacccaatcccaacccct
aatggcaccaccaatgggctgcacgccggtgaagattccgtccagacgccggccgtggac
tccaccggagcttcggcagagaacgaatccttgaggaagaggagaggtagtggtgtccta
cccctcgaggtgggtactcgagtaatgtgccgctggagagacggcaagtaccatcctgtt
aaggtcattgaacgccggaaatttccatgcggcggtgttaatgactacgaatactatgtt
cattacactgaattcaaccggagacttgatgagtgggttaaacttgaacaacttgatctt
aactcagtagagaccgttgtggatgagaaggtcgaggacaaggtgacaagtttaaaaatg
actcgccaccagaaacggaaaattgacgagactcatgtcgagggccatgaggagcttgat
gctgctagtttgcgagagcatgaagaattcacaaaagttaagaacattgctacaatagaa
cttggaagatatgagattgaaacgtggtacttctccccatttcctccagaatacaatgac
tgttcgaaactgttcttttgtgagttttgtctcaatttcatgaagcgcaaagaacagctt
cagaggcacatgagaaaatgcgatcttaagcatcccccaggtgatgagatctacagaagt
ggtacattgtcaatgtttgaggttgatggaaaaaagaacaaggtttatgggcaaaatcta
tgctacttggccaaattgtttcttgatcacaagactctttattatgatgttgacctgttc
ctcttttacgtgctttgtgaatgtgacgaccgaggttgtcatatggttggttacttttca
aaggaaaagcattcagaagagtcctataacttagcctgcattttaacgcttccaccttat
cagaggaaaggatatgggaaattcctaattgcattctcatatgaactttcaaagaaagaa
ggtaaagtgggcactccagaaaggccactttccgacttgggaatgttgagctataggggt
tactggacgcgtgtgcttctggatatattgaaaaagcacaagggcaatatatctatcaag
gaactaagtgacatgacagccatcaaggcagaagatattttgtccacccttcagggttta
gagttgatccaatatcgaaaggggcagcatgtcatctgcgcagacccgaaagtcttagat
cgtcatctcaaagctgctgggcggggtggcctggaagttgatgtcagcaaattgatatgg
actccgtacaaggagcaaaactaa

DBGET integrated database retrieval system