KEGG   Solanum lycopersicum (tomato): 101257163Help
Entry
101257163         CDS       T02665                                 

Definition
protein disulfide isomerase-like 1-3-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sly00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101257163
Enzymes [BR:sly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101257163
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101257163
  Exosomal proteins of colorectal cancer cells
   101257163
  Exosomal proteins of bladder cancer cells
   101257163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 563 aa AA seqDB search
MAMKKYLILSIFLLNLIFFRTAFSSVVEEEEDLSFLEEEDSDAHSDSNPYGDHHDFENYE
DLEDDSSDHGEDSYEPPAVDEKDVAVLKEGNFSEFISKNKYVMVEFYAPWCGHCQALAPE
YAAAATELKGENVMLAKVDATEEAELAQKYDVQGYPTVFFLIDGVHKTYNGERNKDAIIS
WIKKKTGPVLSNITTVEEAEQILKDEKKVVLGYLNDLVGDKSEELAAAAALEDDVNFYQT
ANPDVAKLFHIDSQAQRPALVIIKKEAENINHFDGEFTKSAIAKFVFENKLPLVTNFTRE
SASEIFENPITKQLILFATSKDSEKFLPIFQEAVKAFKGKLICVFVEIDNEDVGKPVSEY
FGVSGDAPRVLAYTGNEDGRKFILEGEITLDGVKSFGEKFLEDNLKPFYKSDPIPETNDG
DVKIVVGNNFDEIVLDESKDVLLELYAPWCGHCQSLEPIYNKLGKHLRGIDSLVIAKMDG
TTNEHPRAKSDGFPTLLFFPAGNKSFEPITVDTDRTVVAFYKFLKKHASTPFKIQKPVST
QRTTESDASLSHESTTNDAKDEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaagaaatatctaattctctccatttttctactcaatctcatcttcttcaga
actgctttctcttctgttgttgaagaagaagaggatctcagtttccttgaagaagaggat
tccgatgctcattcagattccaatccatatggtgaccaccacgattttgagaactacgaa
gatctcgaggacgattcttccgatcacggagaagactcgtatgagccgccagcagtggat
gagaaggatgtggctgtattgaaggaagggaattttagtgaatttatttcgaagaataag
tatgttatggttgagttctatgcgccgtggtgtggtcattgtcaggcacttgcaccggag
tatgctgcagccgcgactgagctgaaaggagagaatgtgatgcttgctaaagtagatgct
actgaggaagctgaacttgctcaaaagtatgatgtgcaagggtatcccactgttttcttc
ctcattgatggtgttcacaagacctataatggtgaaaggaataaggatgctattatttca
tggataaaaaagaagaccgggcctgttctatccaatataacgactgtagaggaggcagaa
caaatcttgaaagatgagaaaaaagtagtgttgggttatttgaatgatttggtgggtgat
aaaagtgaagagcttgctgcagctgctgcactagaagatgatgtcaacttctatcagact
gccaatccagatgtggcaaaactcttccatattgattctcaagcccaacgtccagctctt
gtcataattaagaaagaagccgagaatatcaaccactttgatggtgaattcaccaagtca
gcaatagctaagtttgtttttgagaacaagcttcctcttgtcaccaattttactcgggaa
agtgcctcagagatatttgaaaatcccattacgaagcagttgatactttttgccacttcg
aaagattcagaaaaattcttaccaatatttcaagaagctgtgaaagcttttaaaggaaag
cttatctgtgtgtttgttgaaatcgacaacgaagatgttggaaaaccagtttcagagtac
tttggtgttagcggtgatgccccaagagttctcgcatatacaggaaatgaggatgggagg
aagtttatactggaaggtgaaataaccttggatggtgtcaagtcatttggggagaagttt
ttggaagacaatttaaagcctttctacaaatctgatccaattcctgagactaatgatggg
gatgtcaaaattgtggttggcaataactttgacgaaattgttttggatgaatcaaaagat
gttcttcttgagttatatgctccttggtgtggacattgtcaatcactagaacccatatac
aacaagcttggcaagcatttaagaggcattgactcccttgttattgccaagatggatggt
acaacaaacgagcatcccagagccaagtctgatggattcccaacacttctgttcttccca
gctggcaacaagagctttgaacctattactgttgacacagatcgtacagttgttgccttt
tacaaattcctgaaaaagcatgcatctaccccgttcaagattcaaaagccagtctcaaca
cagagaactacagagtctgatgccagtttaagccacgagagcaccactaatgacgctaag
gatgaactgtga

DBGET integrated database retrieval system