KEGG   Solanum lycopersicum (tomato): 101258151Help
Entry
101258151         CDS       T02665                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101258151
Enzymes [BR:sly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101258151
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101258151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 847 aa AA seqDB search
MEINFNVLSKPIRGSFPFSSPRVSPRGQGQSSEQMDMLLALSLDGRGVKASRTKICFPSQ
HSTGLKFGSEGRSWDISSTPKSRVRKDERMKHSSAISAVLTNDNSTMASREEDVKTENIG
LLNLDPALEPYLDHFRYRMKRYVDQKMLIQKYEGGLEEFAQGYLKFGFNREDGCIVYREW
APAAQEAEVIGDFNGWNGSNHMMEKDQFGVWSIRIPDVDSKPAIPHNSRVKFRFKHGEGA
WVDRIPAWIKYATVDATKFAAPYDGVYWDPPPSERYNFKYPRPSKPRAPRIYEAHVGMSS
SEPRVNSYREFADDVLPRIKANNYNTVQLMAIMEHSYYGSFGYHVTNFFAVSSRSGNPED
LKYLIDKAHSLGLQVLVDVVHSHASNNVTDGLNGFDIGQGSQESYFHAGERGYHKLWDSR
LFNYANWEVLRFLLSNLRWWLEEYNFDGFRFDGITSMLYVHHGINMGFTGNYNEYFSEAT
DVDAVVYLMLANNLIHKIFPDATVIAEDVSGMPGLGRHVSEGGIGFDYRLAMAIPDKWID
YVKNKNDEDWSMKEVTSSLTNRRYTEKCIAYAESHDQSIVGDKTIAFLLMDKEMYSGMSC
LTDASPVVDRGIALHKMIHFFTMALGGEGYLNFMGNEFGHPEWIDFPREGNNWSYDKCRR
QWNLADSQHLRYKFMNAFDRAMNSLDEKFSFLASGKQIVSSIDDDNKVVVFERGDLVFVF
NFHPNNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTSPEGIPGVPETNFN
GRQIPSNCCLLRTHVWLITELTNACQKLKFTRQTFLMSYYQQPISRRVTRNLKIHYLQIS
VTSVRLL
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaatttcaatgttttatcaaaacccattcgaggatcttttccattttcctca
cctagagtttctccacggggtcaaggccaaagttctgaacaaatggacatgcttttagct
ctttccctggatggaagaggagtaaaagcttctagaactaagatatgttttccttctcaa
catagtactggactgaagttcggatctgagggacggtcttgggatatttctagcacccca
aaatcaagagttagaaaagatgaaaggatgaagcacagctcagctatttccgctgttttg
accaatgataactcgacaatggcatccagagaggaagatgtcaagactgaaaatattggc
ctcctaaatttggatccagctttggaaccttatctagatcacttcagatacagaatgaag
agatatgtggatcagaaaatgctcattcaaaaatatgagggaggccttgaggaatttgct
caaggttatttaaaatttggattcaacagggaagatggttgcatagtctatcgtgaatgg
gctcctgctgctcaggaagcagaagttattggtgatttcaacggatggaacggttccaac
cacatgatggagaaggaccagtttggtgtttggagtattagaattcctgatgttgacagt
aagccagccattccacacaactccagagttaagttccgtttcaagcatggcgagggagcg
tgggtagatcgtatccctgcttggataaagtatgccactgtagacgccacaaagtttgca
gcaccatatgatggtgtctactgggacccaccgccttctgaaaggtacaacttcaaatac
cctcgcccttccaaaccccgagccccacgaatctacgaagcacatgtcggcatgagcagc
tcagagccacgtgtaaattcgtatcgtgagtttgcagatgatgttttacctcgaattaag
gcaaataactataatactgtccagttgatggccataatggaacattcttactatggatca
tttgggtatcatgttacaaacttttttgctgtgagcagtagatctggaaatccggaggac
ctaaagtatctgatagataaagcacatagcttgggtttacaggttctggtggatgtagtt
cacagtcatgcaagcaataatgtcactgatggcctcaatggctttgatattggccaaggt
tctcaagaatcctactttcatgccggagagcgagggtaccataagttgtgggatagcagg
ctgttcaactatgccaattgggaggttcttcgtttccttctttccaacttgaggtggtgg
ctagaagagtataactttgacggatttcgatttgatggaataacttctatgttgtatgtt
catcatggaatcaatatggggtttacaggaaactataatgagtatttcagcgaggctaca
gatgttgatgctgtcgtctatttaatgttggccaataatctgattcacaagattttccca
gacgcaactgttattgccgaagatgtttctggtatgccgggccttggccggcatgtttct
gagggaggaattggttttgattatcgcctggcgatggcaatcccagataagtggatagat
tatgtaaagaacaagaatgatgaagattggtccatgaaggaagtaacatcgagtttgaca
aataggagatatacagagaagtgtatagcatatgctgagagccatgatcagtctattgtc
ggtgacaagaccattgcatttctcctaatggacaaagagatgtattctggcatgtcttgc
ttgacagatgcttctcctgttgttgatcgaggaattgcgcttcacaagatgatccacttt
ttcacaatggccttgggaggagaggggtacctcaatttcatgggtaacgagtttggccat
cctgagtggattgacttccctagagagggcaataattggagttatgacaaatgtagacgc
cagtggaacctcgcggatagtcaacacttgagatacaagttcatgaacgcatttgataga
gctatgaattcactcgacgagaagttctcattccttgcatcaggaaaacagatagtaagc
agcatcgatgatgataataaggttgttgtgtttgaacgtggtgacctggtatttgtattc
aacttccacccaaataacacatacgaagggtataaagttggatgtgacttgccagggaag
tacagagttgcactggacagtgatgcttgggaatttggtggccatggaagagttggtcat
gatgttgaccatttcacatcaccagaaggaatacctggagttccagaaacaaatttcaat
ggtcgtcaaattccttcaaattgctgtctcctgcgcacacatgtgtggcttattacagag
ttgacgaatgcatgtcagaaactgaagtttaccagacagacatttctaatgagctactac
caacagccaatatcgaggagagtgacgagaaacttaaagattcattatctacaaatatca
gtaacatcggtcagactgttgtag

DBGET integrated database retrieval system