KEGG   Solanum lycopersicum (tomato): 101258377Help
Entry
101258377         CDS       T02665                                 

Definition
(RefSeq) histone deacetylase 6
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101258377
Chromosome [BR:sly03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101258377
   HDAC complexes
    Sin3A-HDAC complex
     101258377
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101258377
  Chromatin remodeling factors
   NuRD complex
    101258377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 471 aa AA seqDB search
MDSSTVDGGASLPSTGTDARKRRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHNLIVNYYL
HRRMEISRPFPAGEDDIRRFHSPDYVDFLATVSPETLHDHTHSRHLKRFNVGEDCPVFDG
LFGFCQASAGGSIGAAVKLNRQDADITINWAGGLHHAKKSEASGFCYVNDIVLGILELLK
VHKRVLYIDIDIHHGDGVEEAFFTTDRVMTVSFHKFGDFFPGTGHIKDIGANQGKYYALN
VPLHDGMDDDSFGRLFRPTIQKVMEVYQPEAVVLQCGADSLAGDRLGCFNLSVKGHAACL
RYLRSFNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPENKLPYNEYYEYFGPDYTLHV
EPIPMENLNSPRDLEKMRNILLEQISQLPHAPSVPFQTTPSTTEVPEEKEENMDRRPKPR
IWNGDGYESDADEDEKPRQRSSDSNLTPVESSDMRDVDDQANADDMVDDHP
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggactcctccaccgtagacggcggcgcatcgcttccatcaaccggaaccgacgctagg
aagcgtcgtgtctcttacttctatgagccaaccatcggcgattattactacggccaaggt
catccgatgaagccgcaccgtatcagaatggcccacaatctcatcgtaaactactaccta
cacaggcgtatggaaatcagtcgtccttttccggcgggagaggatgatatccgacgtttt
cactcgccggattatgttgacttccttgctaccgtttcaccggagactcttcatgaccat
acacattcacgtcatctcaaacggtttaatgttggtgaggattgtcctgttttcgatggg
ctttttgggttttgtcaagcttctgctggtggatctattggggctgcggttaagcttaat
cggcaggatgctgatataacgatcaactgggctggtggtctgcaccatgcaaagaaaagt
gaagcttctggtttttgctatgtgaatgatattgttcttggtattcttgagctcctcaaa
gtccacaagcgtgtattgtacatagacattgatattcaccatggtgatggtgttgaggag
gcttttttcaccacagatagagtcatgacagtatcttttcataagtttggggatttcttt
cctggtacggggcacatcaaagacattggtgcaaatcaggggaagtactatgccctaaat
gtcccattgcatgatgggatggatgacgatagttttggtagactatttcgtcccacaata
caaaaagtcatggaggtctaccaacctgaggctgttgttcttcaatgtggggctgattca
ctggctggagacaggttgggttgcttcaacttgtctgtcaagggccatgccgcttgcctt
aggtacctcagatccttcaatgtccctctgatggtattgggtggtggaggttatactata
agaaatgtcgctaggtgctggtgctatgagacagcagttgcagttggggtagaacctgaa
aacaagttgccttacaacgagtattatgaatattttggcccagattatactcttcatgtt
gaaccaattcccatggagaatctaaattcacctagggatctggagaagatgaggaacata
ttgcttgagcaaatctctcagttgcctcatgcacctagtgtgccatttcagaccactcct
tctacaacagaagtcccagaggagaaagaggaaaatatggatcgaaggcctaaaccacgg
atatggaatggtgatggttatgagtctgatgctgatgaagacgagaaacctagacagcga
agttcagatagtaatcttactccagtggaatcatctgacatgagggatgtggacgaccaa
gccaatgcagatgacatggttgatgatcatccctag

DBGET integrated database retrieval system