KEGG   Solanum lycopersicum (tomato): 101258377Help
Entry
101258377         CDS       T02665                                 

Definition
histone deacetylase 6-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
sly  Solanum lycopersicum (tomato)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 471 aa AA seqDB search
MDSSTVDGGASLPSTGTDARKRRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHNLIVNYYL
HRRMEISRPFPAGEDDIRRFHSPDYVDFLATVSPETLHDHTHSRHLKRFNVGEDCPVFDG
LFGFCQASAGGSIGAAVKLNRQDADITINWAGGLHHAKKSEASGFCYVNDIVLGILELLK
VHKRVLYIDIDIHHGDGVEEAFFTTDRVMTVSFHKFGDFFPGTGHIKDIGANQGKYYALN
VPLHDGMDDDSFGRLFRPTIQKVMEVYQPEAVVLQCGADSLAGDRLGCFNLSVKGHAACL
RYLRSFNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPENKLPYNEYYEYFGPDYTLHV
EPIPMENLNSPRDLEKMRNILLEQISQLPHAPSVPFQTTPSTTEVPEEKEENMDRRPKPR
IWNGDGYESDADEDEKPRQRSSDSNLTPVESSDMRDVDDQANADDMVDDHP
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggactcctccaccgtagacggcggcgcatcgcttccatcaaccggaaccgacgctagg
aagcgtcgtgtctcttacttctatgagccaaccatcggcgattattactacggccaaggt
catccgatgaagccgcaccgtatcagaatggcccacaatctcatcgtaaactactaccta
cacaggcgtatggaaatcagtcgtccttttccggcgggagaggatgatatccgacgtttt
cactcgccggattatgttgacttccttgctaccgtttcaccggagactcttcatgaccat
acacattcacgtcatctcaaacggtttaatgttggtgaggattgtcctgttttcgatggg
ctttttgggttttgtcaagcttctgctggtggatctattggggctgcggttaagcttaat
cggcaggatgctgatataacgatcaactgggctggtggtctgcaccatgcaaagaaaagt
gaagcttctggtttttgctatgtgaatgatattgttcttggtattcttgagctcctcaaa
gtccacaagcgtgtattgtacatagacattgatattcaccatggtgatggtgttgaggag
gcttttttcaccacagatagagtcatgacagtatcttttcataagtttggggatttcttt
cctggtacggggcacatcaaagacattggtgcaaatcaggggaagtactatgccctaaat
gtcccattgcatgatgggatggatgacgatagttttggtagactatttcgtcccacaata
caaaaagtcatggaggtctaccaacctgaggctgttgttcttcaatgtggggctgattca
ctggctggagacaggttgggttgcttcaacttgtctgtcaagggccatgccgcttgcctt
aggtacctcagatccttcaatgtccctctgatggtattgggtggtggaggttatactata
agaaatgtcgctaggtgctggtgctatgagacagcagttgcagttggggtagaacctgaa
aacaagttgccttacaacgagtattatgaatattttggcccagattatactcttcatgtt
gaaccaattcccatggagaatctaaattcacctagggatctggagaagatgaggaacata
ttgcttgagcaaatctctcagttgcctcatgcacctagtgtgccatttcagaccactcct
tctacaacagaagtcccagaggagaaagaggaaaatatggatcgaaggcctaaaccacgg
atatggaatggtgatggttatgagtctgatgctgatgaagacgagaaacctagacagcga
agttcagatagtaatcttactccagtggaatcatctgacatgagggatgtggacgaccaa
gccaatgcagatgacatggttgatgatcatccctag

DBGET integrated database retrieval system