KEGG   Solanum lycopersicum (tomato): 101258844Help
Entry
101258844         CDS       T02665                                 

Definition
formamidopyrimidine-DNA glycosylase-like
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sly03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 446 aa AA seqDB search
MPELPEVEAARRAIEDNCIGKKIVKAIIADDSKVIDGVSPVDLKASLEGKTIVAANRKGK
NMWLELDSPPFPTFQFGMAGAIYIKGVAVTKYKRSAVKDDDEWPSKYSKVFLELDDGLEL
SFTDKRRFARVRSLENPVSVPPISELGPDALLEPMTVDEFYKALSKKKIGIKALLLDQSF
ISGIGNWIADEVLYQARIHPMQSASSISKEDCATLLKCINEVIKKAVEVEADSSQYPSNW
ISHSREKKPGKAFVDGKKIEFITAGGRTSAFVPELQQNTGAESAKAAGKRQQVKVQKIKH
NDSDSQDEEPEIEETAAGKSKVKQRGANTKRASTNKKSKESNSDDENDSDEAPKKSGKAK
QNKSSKGKGGDKKKKTRGTNTAAKRKLEESDDEEDTDDNDASGDDDDSEQDKDQNLSSKT
QSKGKKTTKQMAEPRQTRNKPSKKQK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcttccagaggtagaggcagctcgaagagccattgaggacaactgcattggc
aagaaaattgtgaaagctatcatcgccgacgattccaaggtcatcgacggcgtatctcct
gtggatttgaaagcatctcttgagggcaaaactatcgtagctgctaatcgcaaagggaaa
aatatgtggcttgagctcgattcccctccttttcctactttccagttcggaatggcgggt
gctatatatatcaagggagttgcagttacaaaatataaacggtctgcagtaaaagacgat
gatgagtggccttccaagtattcaaaggttttccttgagttggatgatggtctggagctt
tcatttacggataagaggcggtttgccagggttcgctcattggagaatccggtgtctgtt
cctccaatatctgagcttggtcctgatgcattgttggagccgatgactgtagacgagttc
tataaagctttgagtaagaagaagattggcattaaagctttattacttgaccagagtttt
atttcaggaattggcaactggattgcagatgaagtgttatatcaggcgagaatccatcct
atgcagtccgcttcaagcatatccaaagaggactgtgcaacattgctgaagtgcattaac
gaggtcatcaaaaaagctgttgaagttgaggcagatagtagtcagtatccttctaattgg
atttcccattcccgggaaaagaaacctggcaaggcctttgttgatgggaagaaaatagaa
ttcatcacggcaggtggcaggacatcagcctttgttccagagctacaacagaatacgggg
gctgaatctgcaaaagcggcaggtaaacggcaacaggtgaaagttcagaaaatcaagcat
aacgatagtgatagtcaagatgaagagccagaaattgaagagacagcagctgggaagtca
aaggtgaagcagcgtggggcaaatactaagagagcttctactaacaagaagtcaaaggaa
agcaacagtgatgatgaaaatgatagcgatgaagctccaaagaaatctggaaaagcaaaa
caaaacaaaagctccaagggaaaaggtggtgataaaaagaagaaaactagaggaacaaat
acggctgcaaaaagaaaactagaggaaagtgatgatgaggaagacaccgacgataatgat
gctagtggggatgacgatgatagtgaacaggacaaggatcaaaatctttctagtaaaaca
caatcaaaggggaagaagaccaccaagcaaatggctgaaccaaggcagactaggaataag
ccatcgaagaagcagaaataa

DBGET integrated database retrieval system