KEGG   Solanum lycopersicum (tomato): 101260239Help
Entry
101260239         CDS       T02665                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101260239
   01210 2-Oxocarboxylic acid metabolism
    101260239
   01230 Biosynthesis of amino acids
    101260239
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101260239
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101260239
   00220 Arginine biosynthesis
    101260239
Enzymes [BR:sly01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101260239
Amino acid related enzymes [BR:sly01007]
 Aminotransferase (transaminase)
  Class I
   101260239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 542 aa AA seqDB search
MRRFISHKTINLISKTTTSTISSSSSPNSPSLSPNSPLNSLLRFFSALPAYSPDSMASDY
SATHITVDNINPKVLKCEYAVRGEIVSIAQTLQQRLKDNPGSHPFDEILYCNIGNPQALA
QQPITFFREVLALCDHPSILDKSETQGLFSADAIERAFQILEQIPGRATGAYSHSQGIKG
LRDTIASGMGARDGFPADPNDLFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSAS
IALHGGTLVPYYLDEQTGWGLEISELEHQLKTAKSKGIDVRALVVINPGNPTGQVLGEAN
QREIVEFCRKEGLVLLADEVYQENVYVPDKKFHSFKKVSRSMGYGETDITLVSFQSVSKG
FYGECGKRGGYMEITGFSPEVREQIYKLASVNLCSNISGQILASLIMSPPKVGDESYESF
SAEKEAILSSLARRAKTLEDALNSLEGVTCNRAEGAMYLFPCINLPDKAIKAAEAAKTAP
DAFYAKHLLNATGIVVVPGSGFRQVPGTWHFRCTILPQEEKIPAIVSRLTEFHKKFMDEF
RG
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagattcatatcacacaaaaccataaatctcatcagcaaaaccacaactagtact
atttcgtcttcttcttctccaaattctccatcactttctcctaattctccattaaattct
cttcttcgtttcttctccgctcttcctgcttattctcctgattcaatggcttcagattat
tcagcaactcacatcactgttgataatattaatccaaaggttttgaaatgtgagtatgct
gttcgtggagagattgtatcaattgctcagacattgcagcaaaggctcaaggataatcca
ggttctcatccttttgatgagatcttatattgcaatattggaaatcctcaagcacttgct
cagcagcctatcactttctttagagaggtccttgcgttatgtgatcatccatccattttg
gacaaaagtgaaacacaaggtctattcagcgcggatgccatagaacgagctttccagatc
cttgaacaaattcctgggagagcaactggtgcatacagccacagtcagggtatcaaagga
ttacgtgatacaatcgcttctggtatgggagctcgtgatggtttccctgctgatccaaac
gatcttttcttgactgatggtgcaagcccagcggttcacatgatgatgcagctgctcatc
aggtcagagaatgatggaattctctgtcccattccccagtatcctctttactctgcttca
atcgccctccatggtggaactcttgttccttattatcttgatgaacaaacaggctggggg
cttgagatctcagagcttgagcatcagttgaaaactgcaaaatccaagggtattgatgtt
agggctttggttgtgatcaatccgggcaacccaactgggcaggttcttggtgaggccaac
caacgggaaattgtagaattctgcaggaaggaaggtctcgtccttctggctgatgaagtt
tatcaagaaaatgtttatgtgcctgacaagaaattccactcatttaagaaagtttcccgc
tctatgggatatggggaaacggatataaccttagtgtcttttcagtctgtgtcaaaaggg
ttctatggtgagtgtggaaagcgaggaggttacatggagatcactggttttagccctgaa
gtgagggaacagatatacaaattggcgtctgtcaatctgtgttccaatatctctggtcag
atacttgcaagcctcatcatgagtcccccaaaggtaggagatgaatcatacgagtctttt
tctgccgagaaagaagcaatactctcgtccttggcaagacgtgcaaagacactagaagat
gcactgaatagtttggaaggagtgacatgcaatagggcagaaggggctatgtatctattt
ccgtgtatcaacttacccgacaaagcaataaaagcagcagaagcagctaaaactgcacca
gacgctttttatgctaaacaccttcttaatgccactggaatcgttgttgttccaggctct
ggattccgccaggttcctggaacctggcattttaggtgcacaatattaccacaagaagag
aagataccagctatcgtgtctcgtctgacagaattccataaaaagttcatggatgaattc
cgcggctaa

DBGET integrated database retrieval system