KEGG   Solanum lycopersicum (tomato): 101260413Help
Entry
101260413         CDS       T02665                                 

Definition
histone deacetylase 15-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101260413
Protein phosphatases and associated proteins [BR:sly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101260413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 610 aa AA seqDB search
MILVQKCVTNSEGNEISESSKMSNLTGGKTETNLPNQSGVALCQDLNGRLDGVGSAVVCD
YTCHNDGQSGEVSQLGTRDSDGISGLNADPAAITKSAKHESDMTLEDMYNARYNFDEDDD
DSDWEPSEKQIEVLKWFCVNCSMINVEDVGNCEVCGEHRESGILRHGFFASPYLPVEDIN
QDELPVTEDSEDSCKQSSLSSSTAVGFDERMLLHTEVVLKSHPHPERPDRLRTIAASLAT
AGIFPGKCHPIPAREITREELQMIHSEENIEAVDNTKRMHASYFTPDTYANEYSACAARL
AAGLCADLASAIYSGCVKNGFALVRPPGHHAGVKQAMGFCLHNNAAIAASAAQAAGAKKV
LIVDWDVHHGNGTQEIFERSKSVLYISLHRHEGGRFYPGTGAADEVGSMGAEGYCVNIPW
SRGGVSDNDYIFAFEQVVLPIALDFNPDFTIISAGFDAARGDPLGCCDVTPAGYASMTQM
LSALSGGKLLVILEGGYNLRSISSSATAVIKVLLGESPVIDIDKAVPSKAGLRSVLDVLK
IQMNFWPTLEANFTKLHSQWGSYAFQDTREQSKKRRRTGLPIWWRLGRKRLLYRVLSKQL
RAKSSCNFSC
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagtgcaaaaatgtgttactaattctgaaggcaatgagatctcagaatcatct
aaaatgagcaatttaactggtggaaagactgaaaccaatcttccaaatcaatcgggagtt
gctctatgtcaagatttaaatggaagattagacggggttggctccgcggttgtttgtgat
tatacttgtcataatgatggacaatctggggaggtgtcacaacttggtactagagactca
gatgggatctctggtttgaatgctgatccagctgctataactaaaagtgctaagcacgaa
agtgatatgaccttggaggatatgtataatgctcggtataattttgacgaggatgatgat
gacagtgactgggaaccatcagaaaagcaaatagaagttctgaagtggttctgtgtcaat
tgttcaatgatcaatgtcgaggatgttggcaattgtgaagtatgcggagaacacagagaa
tctgggatactcaggcatggattttttgcatctccatatctgcctgtagaagatatcaac
caagatgaattgcctgtaactgaagattctgaagattcatgcaagcaaagttctttatca
tcctccactgctgtagggtttgacgagaggatgttgcttcacacagaagtcgtattgaag
tctcatccacatcctgagagaccagaccgtcttcgaaccattgcagctagccttgcaaca
gcaggtatattcccagggaagtgccatcccattcctgcaagagagattactagggaagaa
ctccagatgatacactcagaggaaaatattgaagccgttgataacaccaagcgtatgcat
gccagttatttcacacctgatacctatgcaaatgaatattcagcatgtgctgccaggctt
gcagcaggtttatgtgctgaccttgcttcagcaatttactctggatgcgtcaaaaatggt
tttgctctggttcgtcctcctggccaccatgctggtgtgaaacaggccatgggcttctgt
ctccacaacaatgcagcaattgctgcatcagcagctcaggcggctggtgcaaagaaggtg
ttaatagttgattgggatgtgcatcatgggaatggcacacaagaaatatttgagagaagc
aaatcggttttgtatatatcattgcatagacatgagggtggaagattctaccctggtaca
ggagctgcagatgaggttggttctatgggtgcagaaggatactgtgtgaatattccttgg
agccgtgggggagtgagtgacaatgactacatttttgcatttgagcaagtcgtgcttccc
atagctttggatttcaatccagactttactatcatttcagcaggatttgatgctgctagg
ggtgacccccttggctgctgtgacgtaactcctgctggttatgcatcaatgactcagatg
ttgagtgcattgtcaggtggaaaattgcttgttattttggaaggcggctacaatcttcgc
tcaatttcatcatcagctacagcagtgattaaggtcttgcttggtgaaagtccagtgatt
gacatagacaaagctgtaccttccaaagctggactgcgaagtgttttggatgttctaaag
attcagatgaacttctggcctacactggaggcaaacttcactaaattgcattcgcagtgg
ggatcctatgcttttcaggacacaagagaacagagtaaaaaaagacgcaggactggttta
ccaatatggtggagattgggacgaaagaggctgttgtatcgcgtactgtccaagcagctg
cgtgcaaagtcctcttgtaatttttcttgttga

DBGET integrated database retrieval system