KEGG   Solanum lycopersicum (tomato): 101261171Help
Entry
101261171         CDS       T02665                                 

Definition
polyprenol reductase 2
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101261171
    1.3.1.94  polyprenol reductase
     101261171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 343 aa AA seqDB search
MLPGKKMELGLVTLLRAAWVAAILPVVIALIPSSKISFFQKFVLGFAKRGKIMQSSSNKL
SVPQKLFIHFYILAFVWTTLLLVATWLYDYCTMPKITEPLLFSSIASHLTGGSRIFSSHS
SHTSKEHRSRIAVSIFLLLLMEAQVLRRLFESIYVFKYSPSARMHILGYLTGLFFYTAVP
ISLCCNHATEVYKFGLSLIQEFIVKGKDRMLATEVDWWRFLNPLIQLQWYSWIGAAIFFW
GWIHQHRCHAILGSLRENRKDNDEYAVPYGDWFQYVSSPHYLAEIVVYAGFVVASGCSDL
TIWLLWGFTVANLVLAAAETHRWYLHKFDNYPRNRFAIFPYVY
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccggaaaaaaaatggagttagggctggtcaccctgttgagagctgcatgggtt
gctgcgatattgcccgttgttatcgctttgattccttcatccaagatcagtttttttcaa
aaattcgtgttagggtttgctaagcgtggcaagattatgcagtcttcatcaaataaattg
tctgttccacagaaactcttcattcacttctatattctagcttttgtttggacaacactt
ctgttagttgcaacctggctttatgattattgtacaatgccaaagatcacagaaccattg
cttttttctagtattgctagccacttgacgggaggatcgcgtatcttctcttcgcacagt
tctcatacatcaaaggaacatagaagcaggattgctgtatcgatctttcttcttttatta
atggaagctcaagtactgcgacgcctgtttgagtcaatatacgttttcaaatatagtcct
tcagccaggatgcacattttaggctacctcacaggtttatttttctatacagcagttccc
atctctctttgctgcaatcatgctacagaggtatacaagttcgggttgagtttgattcaa
gagtttattgtcaaaggaaaagataggatgctagcaactgaggttgattggtggagattt
ttgaaccctctcattcaactacaatggtactcatggattggtgcagctatatttttttgg
ggctggattcatcaacaccgttgtcatgcaattctgggatcattgagggaaaacagaaaa
gacaatgatgaatatgcagttccttatggtgattggtttcaatatgtttcatctccacac
tatttggctgagattgttgtatatgctggctttgtggttgctagtggatgttcggacctc
actatatggctactctggggattcacggtggcaaatcttgtcttagcagcagcagaaaca
cacagatggtatttgcacaagtttgacaactatcctaggaatcgttttgctatttttcca
tatgtttattga

DBGET integrated database retrieval system