KEGG   Solanum lycopersicum (tomato): 101261348Help
Entry
101261348         CDS       T02665                                 

Definition
histone deacetylase 2-like
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101261348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 347 aa AA seqDB search
MSSAASSSKTDDAEALRRSRILSSPLYYDVPPSKVPLIYSSSYDIAFFGIEKLHPFDSSK
WGRICRFLTKEGIMDQKHVVEPVEATKDDLLVVHSESYLKSLNSSLNVSMIIEVPPVAML
PNCLVQKKVLHPFRKQVGGTILAAKLAKERGWAINVGGGFHHCSSEKGGGFCVYADISLC
IHFAFVRLNISRVMIIDLDAHQGNGHEMDFSDDRRVFILDMYNPRIYPLDFEARRYIDLK
VEVKSGTATDEYLTKLDHALEVAEKRFDPDFIVYNAGTDILDGDPLGRLKISPDGIASRD
EKVFRFARERSIPLIMLTSGGYMKSSAKVIADSIVNLSSKSLIDMKS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgctgcctcttcctccaaaaccgacgacgctgaagctctacgccgtagccgt
attctctctagccccctatattacgatgtgcctccttctaaggttccgttgatatactcg
tcatcctacgacattgctttttttgggattgaaaaactgcatccatttgactcttctaaa
tggggtcgaatctgtcggtttctcactaaggaaggtatcatggaccaaaagcatgtagtt
gagcctgtggaggcaactaaagatgatctgctagtggtgcattctgaatcatacctgaaa
agtttgaacagcagcttgaatgtctccatgattattgaggtccctcctgttgcgatgctt
cctaattgccttgtgcaaaagaaagtgctccaccccttccgcaagcaggtgggaggaaca
attttggctgcaaagcttgcaaaagaacgaggatgggctattaatgttggtggtggattt
catcattgctcatcagagaagggaggcggtttttgtgtttatgctgatatatctctttgt
atacattttgcatttgtgcgtctaaatatctcaagggtcatgataattgaccttgatgca
caccaaggaaatggccatgaaatggacttctctgatgacagaagagtctttatccttgat
atgtacaatcccagaatttatccacttgattttgaagccaggcgttacattgatctgaaa
gtcgaagttaagagtgggactgcgacagatgaatacttaactaagctagatcatgcactt
gaggttgcagagaagagatttgatcctgatttcattgtttataatgctggtactgatatc
ttggatggggatccacttggcaggttgaagatcagtcctgatggcattgctagtagggat
gaaaaagttttcaggtttgctcgagagagaagcatccccctcatcatgctcacatcaggc
ggttacatgaaatcgagtgccaaagttattgctgattccatcgtaaatctctctagtaaa
tccctgatagatatgaagagctag

DBGET integrated database retrieval system