KEGG   Solanum lycopersicum (tomato): 101261555Help
Entry
101261555         CDS       T02665                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sly00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sly00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 954 aa AA seqDB search
MSDSVTFPGDMLINGSNKGGRECCKDSEVTVDPAKLPSLTWQRKLNCDDISLSEFDLKLK
EVVSLAPLGFRLWKFLQEEKAKGKDALFINPFIKRVYSSCQGVPLGGMGAGSIGRSFKGE
FLRWQIFPRICEDKPVLADQFSIFVTRPNGEKYSTVLCPRTPNDSSASGIGSWDWNLGGQ
NSTYHGLYPRAWTVYDGEPDPALRIVCRQISPFIPHNYKESSLPTSVFTFTLHNLGNTSA
DVTLLFTWANSAGGDSGISSHHFNSKFRTDDGVQGVLLHHMTSKELPSVTFAIAAEENDA
VHVSECPFFVISGDSQGITAKDMWNEVKKHGSFDHLQSEEKSMPSEPGSLVGAAVAASLT
IPADDVRSATFSLAWACPEINFGDGKTYQRRYTKFYGTTGHAAAEIAHDAIQEHTQWESQ
IEEWQKPIIEDKRLPEWYPVTLFNELYYLNAGGTIWTDGLPPVQSVSTIGKRFSIERSSS
DVKKNAHLTHSDGTAVSILERMGSVFEELHTPVSVNAAVGTNLLQKGEENIGQFLYLEGI
EYHMCNTYDVHFYASFALAMLFPKVELSIQRDYAAAVMMHDPSKRKLLDDGMSATRNVLG
ALPHDIGMDDPWFEVNYYCLYNTDRWKDLNPKFVLQVYRDFVATGDKKFAEAVWPSVYMA
IAFMDQFDKDGDGMIENEGFPDQTYDVWSVSGVSAYCGGLWVAALQAASALAREVGDKGS
EDYFWFKFQKAKEVYQKLWNGSYFNYDNSGSAVSSSIQADQLAGQWYARACGLLPIVDEE
KAKTALETVFNFNVMKVKDGRRGAVNGMRPSGEPDLSSLQSREIWSGVTYAVAAAMILEG
MVDTGFKTASGVYETVWSEDGFGYAFQTPEGWTTEGRYRALGYMRPLAIWAMQWALNPPK
IPKQEAKPKLEADSLSRQHAGFQAVARLLKLPKEKDARSVFQVLFDYTCKRITG
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattcagttacttttccaggagatatgttgattaatggatctaacaaaggagga
agagaatgttgtaaggatagcgaggtcacggttgacccagcaaaacttccatctttgact
tggcagcgcaagttaaactgtgatgatatttccctttcagaattcgatcttaagctgaaa
gaagtggtttctctggctccattagggttccgtctatggaaatttctacaagaagaaaaa
gccaaaggaaaggatgctctgtttatcaatcctttcataaaaagggtctactcatcatgc
caaggagttcctttaggtggtatgggtgcaggaagcataggaagaagtttcaaaggagaa
tttttgcgctggcaaatatttcctaggatatgtgaagataaaccagttcttgcagaccaa
ttttctatatttgtaacacggccgaatggtgaaaaatattctactgtgttatgcccgaga
actccaaatgattcttcagcttctggaataggatcttgggactggaatttgggtggccaa
aattctacatatcatggtctctatccaagagcgtggactgtatacgatggggaacctgat
ccagcactcaggatagtatgccgtcagatctctccttttatcccccacaactacaaagag
agcagcttacctacatcagtctttacattcacgttgcataacttgggaaatacgtctgca
gatgtcactttgcttttcacctgggcaaattctgctggtggagattctggaatttctagc
catcatttcaattccaagtttagaacggatgatggagtccaaggcgtactcttgcaccac
atgacttccaaagaactcccttctgtaacttttgcaattgcagcagaggaaaatgatgca
gttcacgtctctgagtgccctttctttgtgatatctggcgactcccagggtattacagca
aaagacatgtggaatgaagttaaaaagcatggatcctttgaccaccttcaatctgaggaa
aagtcaatgccttctgaaccgggatcacttgttggagcggcagttgcagcttcactaact
attccagcagatgatgtaagaagtgcaacattctcattggcatgggcctgccctgaaatt
aattttggagatggtaaaacttatcagaggcgctacactaagttctatggtactacgggt
catgctgctgcagaaattgcacatgatgctatccaagagcatactcagtgggagtcacaa
atagaagaatggcaaaaacctattattgaagacaagaggcttcccgaatggtacccagta
acactcttcaatgagctctattatttaaatgcaggagggacaatttggacagatggattg
ccaccagttcaaagtgtatcaacaattgggaaaagattttccattgaaagatctagttcg
gatgttaagaaaaatgctcatttaacccattcagatggcactgctgttagtattcttgag
aggatgggttcggtgtttgaggaacttcatactcctgtctcagtaaatgctgctgtcgga
acaaatcttcttcagaagggagaggaaaatattggccagttcctctaccttgaaggaatt
gaatatcatatgtgtaatacatatgatgttcatttttatgcatcgtttgctttggccatg
ctcttcccaaaagttgaacttagcatacaacgagactatgcagctgctgtgatgatgcat
gatcctagtaagagaaaactcttggatgatggaatgtcagcgacaaggaatgttcttggt
gctcttcctcatgatattggaatggatgatccatggtttgaagtaaattactattgcctg
tataacacagataggtggaaagatttgaacccaaaatttgttcttcaagtttacagggat
tttgttgcgacaggtgacaaaaagtttgccgaagctgtttggccgtctgtgtatatggca
atagctttcatggaccaatttgataaggatggggatgggatgatcgaaaatgaaggattt
cctgatcagacatatgatgtatggtctgtctctggtgtgagtgcttactgtggtggccta
tgggtggcagctttgcaggctgcatcagccctagctcgagaagtaggtgataagggttct
gaagactacttttggtttaagtttcaaaaggcaaaggaagtttatcaaaaattgtggaac
ggttcttacttcaactatgataatagtggcagtgccgtaagctcatctattcaagctgat
caattggctggccaatggtatgctcgagcatgtggtcttctaccaattgttgatgaagaa
aaagccaaaaccgcacttgagacagtgttcaatttcaatgtcatgaaggtcaaggatggg
aggcgtggagcagtgaatggaatgcggcccagtggagaacctgacttgtctagtttgcag
tcaagggagatatggtctggagttacatatgctgtagctgcagccatgattcttgaaggc
atggtggatacgggatttaaaactgcatctggagtctatgaaactgtttggtctgaagat
ggctttggctatgcttttcagaccccagaaggttggaccacagaaggccgatacagagct
ctgggttacatgcgtcctttggcaatctgggctatgcagtgggcattaaacccacctaag
attcccaagcaagaggcgaagccaaaactggaggcagattcattgtctaggcaacatgct
ggttttcaagcggtagctcgtcttctaaagctgcccaaagagaaagatgctagaagtgtt
tttcaggtccttttcgattacacctgtaaaagaataacaggctaa

DBGET integrated database retrieval system