KEGG   Solanum lycopersicum (tomato): 101261878Help
Entry
101261878         CDS       T02665                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101261878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 468 aa AA seqDB search
MGTKHHSSSDPISEPKKRRRVGFSKTDAGIEANDCITIYIVSSAEEVDSPNSFCLEPIDL
NQFFEDDGRIFGYQGLKITILVSLISFHAYADISFESSSDGGRGITNVKSALENIFGESL
VDEKDAFLKTFSTESQYVRSVVSNAETLQHKVSKNGCSTESNCSDVEVFRIAGSPVGQLY
SRLVPLVLLLVDGSNPIDVLDPGWEIYLLVQADKLLGFAAVYRFYRYPGSTRMRLGQILV
MPPYQRKGYGRFLLEVLNRVAVSENVYDLTIEEPEDSLQHVRLCIDVERLLVFDPVQQSL
ESVVSHLKQEKLLEKSYMCKYAPPLSAVEDVRKTLKINKKQFTQCWDILIYLRLAPIDKY
MEIYQAIVSHRVKAEVLGKDSEGAGKQVIDVPTEHDQEMSFVMFKSRNGQSSSSIETADN
QSIVEEQLQKLVDQRMKQIKLIAEKVSSTKAAAMKAEVKFRHEKKESL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggggacgaagcatcattcctcctccgatccaatcagcgaacccaaaaagcgccgtcgc
gtcggattctctaagaccgatgccggaattgaagctaacgactgcattactatatacatt
gtttctagcgcagaggaagttgactccccaaacagtttctgtcttgaaccaattgacttg
aatcaattttttgaagacgatggcagaatatttgggtatcagggtctcaaaatcactatt
ttggttagcttgatatcctttcatgcttatgctgatatttctttcgaaagctcatcagat
ggtggtagagggattacaaacgtaaagtctgctcttgagaatatttttggtgagagtctt
gttgatgaaaaagatgccttcctgaaaacattttcaactgaaagtcagtatgttcggtct
gttgtctcaaatgctgaaacactgcagcataaagtttcaaaaaatggctgtagcactgaa
tcgaactgttcagatgtagaggtattccggatcgctggctcgcctgtagggcagctttat
agtagattggtgccgcttgtactactgttagtggatggtagcaaccctattgacgtcctt
gatcctggatgggaaatttatctcctagtccaggcggataagttgcttggttttgcagct
gtttatcgtttctatcgttatcctggcagtacacgcatgcgacttgggcagatactggtt
atgcctccttaccaacgtaaaggttatggtcgttttcttcttgaggtgttgaacagggtt
gcagtgtctgaaaatgtgtacgacttgacgattgaagagcctgaggattctctacaacat
gttcgattatgcattgatgttgagcgtttgcttgtatttgatccagtccagcaatcccta
gaatcagttgtatcacatttaaagcaggaaaaactattggaaaaaagctacatgtgcaag
tatgctccaccactgagtgctgttgaagatgtgaggaaaactttgaaaatcaacaagaaa
cagtttacgcaatgttgggatattcttatctatcttcggttggccccaattgacaaatat
atggagatataccaagcaattgtttctcaccgagtaaaggctgaagttttaggtaaagat
tcagagggtgcagggaagcaagtgattgatgtaccaactgaacacgatcaggagatgtca
tttgtgatgttcaaatcgcggaatggtcaatctagtagtagcatagagacggctgacaat
caaagtattgtggaggagcagctgcagaaactggtggatcaacgaatgaaacagatcaag
ttgattgctgaaaaggtttcttcgacaaaggcagctgctatgaaggcagaagtaaaattt
cgacatgaaaaaaaggagtctctgtaa

DBGET integrated database retrieval system