KEGG   Solanum lycopersicum (tomato): 101262190Help
Entry
101262190         CDS       T02665                                 

Definition
UDP-glycosyltransferase 76F1-like
Organism
sly  Solanum lycopersicum (tomato)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 457 aa AA seqDB search
MEDEGIKGKRLLFFPLPLQGHITPILQLANILHLKGFSITIILADNFSTTFDNIRANYPH
FTFHTIFDGLSEDDKAKTDIDALFLLSLFNQRCVSHFTEALRELVLEDSNIVCLLSDSIL
HFTKAVADSFKLPRLVLRTGGVCSLLVFAAIPLLINKAYLPLQGMESVQEEAVEELPPYR
VKDLPLFKTCYVDALYQVIEGMIRETKASSGLILNSFEQLEQFSISKLRGDFPIPIFPIG
PFHSHFPASSSSLMSQDQTSISWLDTKPPKSVIYVSFGSIAAIEINEFLEVAWGLANSSH
PFLWVVRPGLIRGSEWIELLPREFLERVDGRGHIVKWAPQQQVLAHPAVGAFWTHSGWNS
TLESICEGVPMICMPCFGDQMVNARHVSHVWKVGVQLENGLKRTNIENALRTLMEDEEGK
QIKERMLALKEKANLCLKPGGSSYESLRSLTSYISSF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgaaggaatcaaagggaagcggttgttgttttttccattgccattgcaagga
cacataacacctatacttcaactagcaaatattcttcacttaaaaggcttttctataact
ataattctggcggataacttcagcaccactttcgataatattcgagcaaattatcctcat
ttcacctttcatactatttttgatggtttatctgaagatgataaggcaaaaacagatatt
gatgccttatttctgctttctttgttcaatcaaaggtgtgtttcgcacttcacagaggct
ttgagagagttagtgttggaagattcaaatattgtttgcttattatcagatagtatcttg
catttcaccaaagccgttgcagacagttttaagcttcctaggcttgttttaaggactgga
ggagtttgttcgttattggtttttgctgccatcccacttttgataaacaaagcttattta
cctcttcaaggtatggaatctgtacaagaggaagcagttgaggaacttcccccttacaga
gttaaagatcttcctttattcaagacatgttacgtggatgcactttatcaagttattgaa
ggaatgatacgagaaactaaagcttcatcaggcctcattctcaattcatttgaacaactt
gaacaattctccatatctaaactccgcggtgattttcctatcccaatttttccaataggc
ccctttcactctcattttccggcttcttccagcagcttgatgtcacaagatcaaacttca
atctcttggctggacacaaaaccacctaaatctgtaatttatgtcagctttggaagcatt
gcagcaatagaaattaatgaatttcttgaggttgcttggggtttggcaaacagtagtcac
cctttcttgtgggtggttaggcccgggttgattcgtggctcagaatggattgaattgtta
cctagagagttcttggagagagtggatggaagaggacacattgtcaaatgggctcctcag
caacaagtgttggcacatcctgctgttggggcattttggacgcacagcggatggaattca
acattggagagtatatgtgaaggggtaccaatgatttgtatgccatgtttcggtgatcaa
atggtgaatgcaaggcatgttagccatgtttggaaagtaggggtgcaattagagaatggc
ttgaagaggacgaacattgagaatgcacttagaacgctgatggaggatgaagaagggaaa
caaatcaaagaaagaatgttagcgctgaaggagaaggcaaatttatgtctaaagccagga
ggttcttcttatgagtctctgaggagccttacaagttacatctcatcattttga

DBGET integrated database retrieval system