KEGG   Solanum lycopersicum (tomato): 101262190Help
Entry
101262190         CDS       T02665                                 

Definition
UDP-glycosyltransferase 76F1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101262190
   00053 Ascorbate and aldarate metabolism
    101262190
   00500 Starch and sucrose metabolism
    101262190
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101262190
Enzymes [BR:sly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101262190
Glycosyltransferases [BR:sly01003]
 Others
  Hydrophobic molecule
   101262190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 457 aa AA seqDB search
MEDEGIKGKRLLFFPLPLQGHITPILQLANILHLKGFSITIILADNFSTTFDNIRANYPH
FTFHTIFDGLSEDDKAKTDIDALFLLSLFNQRCVSHFTEALRELVLEDSNIVCLLSDSIL
HFTKAVADSFKLPRLVLRTGGVCSLLVFAAIPLLINKAYLPLQGMESVQEEAVEELPPYR
VKDLPLFKTCYVDALYQVIEGMIRETKASSGLILNSFEQLEQFSISKLRGDFPIPIFPIG
PFHSHFPASSSSLMSQDQTSISWLDTKPPKSVIYVSFGSIAAIEINEFLEVAWGLANSSH
PFLWVVRPGLIRGSEWIELLPREFLERVDGRGHIVKWAPQQQVLAHPAVGAFWTHSGWNS
TLESICEGVPMICMPCFGDQMVNARHVSHVWKVGVQLENGLKRTNIENALRTLMEDEEGK
QIKERMLALKEKANLCLKPGGSSYESLRSLTSYISSF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgaaggaatcaaagggaagcggttgttgttttttccattgccattgcaagga
cacataacacctatacttcaactagcaaatattcttcacttaaaaggcttttctataact
ataattctggcggataacttcagcaccactttcgataatattcgagcaaattatcctcat
ttcacctttcatactatttttgatggtttatctgaagatgataaggcaaaaacagatatt
gatgccttatttctgctttctttgttcaatcaaaggtgtgtttcgcacttcacagaggct
ttgagagagttagtgttggaagattcaaatattgtttgcttattatcagatagtatcttg
catttcaccaaagccgttgcagacagttttaagcttcctaggcttgttttaaggactgga
ggagtttgttcgttattggtttttgctgccatcccacttttgataaacaaagcttattta
cctcttcaaggtatggaatctgtacaagaggaagcagttgaggaacttcccccttacaga
gttaaagatcttcctttattcaagacatgttacgtggatgcactttatcaagttattgaa
ggaatgatacgagaaactaaagcttcatcaggcctcattctcaattcatttgaacaactt
gaacaattctccatatctaaactccgcggtgattttcctatcccaatttttccaataggc
ccctttcactctcattttccggcttcttccagcagcttgatgtcacaagatcaaacttca
atctcttggctggacacaaaaccacctaaatctgtaatttatgtcagctttggaagcatt
gcagcaatagaaattaatgaatttcttgaggttgcttggggtttggcaaacagtagtcac
cctttcttgtgggtggttaggcccgggttgattcgtggctcagaatggattgaattgtta
cctagagagttcttggagagagtggatggaagaggacacattgtcaaatgggctcctcag
caacaagtgttggcacatcctgctgttggggcattttggacgcacagcggatggaattca
acattggagagtatatgtgaaggggtaccaatgatttgtatgccatgtttcggtgatcaa
atggtgaatgcaaggcatgttagccatgtttggaaagtaggggtgcaattagagaatggc
ttgaagaggacgaacattgagaatgcacttagaacgctgatggaggatgaagaagggaaa
caaatcaaagaaagaatgttagcgctgaaggagaaggcaaatttatgtctaaagccagga
ggttcttcttatgagtctctgaggagccttacaagttacatctcatcattttga

DBGET integrated database retrieval system