KEGG   Solanum lycopersicum (tomato): 101262190Help
Entry
101262190         CDS       T02665                                 

Definition
(RefSeq) UDP-glycosyltransferase 76C4-like
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101262190
   00053 Ascorbate and aldarate metabolism
    101262190
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101262190
Enzymes [BR:sly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101262190
Glycosyltransferases [BR:sly01003]
 Others
  Hydrophobic molecule
   101262190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 463 aa AA seqDB search
MSKNLSMEDEGIKGKRLLFFPLPLQGHITPILQLANILHLKGFSITIILADNFSTTFDNI
RANYPHFTFHTIFDGLSEDDKAKTDIDALFLLSLFNQRCVSHFTEALRELVLEDSNIVCL
LSDSILHFTKAVADSFKLPRLVLRTGGVCSLLVFAAIPLLINKAYLPLQGMESVQEEAVE
ELPPYRVKDLPLFKTCYVDALYQVIEGMIRETKASSGLILNSFEQLEQFSISKLRGDFPI
PIFPIGPFHSHFPASSSSLMSQDQTSISWLDTKPPKSVIYVSFGSIAAIEINEFLEVAWG
LANSSHPFLWVVRPGLIRGSEWIELLPREFLERVDGRGHIVKWAPQQQVLAHPAVGAFWT
HSGWNSTLESICEGVPMICMPCFGDQMVNARHVSHVWKVGVQLENGLKRTNIENALRTLM
EDEEGKQIKERMLALKEKANLCLKPGGSSYESLRSLTSYISSF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaatttatccatggaggatgaaggaatcaaagggaagcggttgttgtttttt
ccattgccattgcaaggacacataacacctatacttcaactagcaaatattcttcactta
aaaggcttttctataactataattctggcggataacttcagcaccactttcgataatatt
cgagcaaattatcctcatttcacctttcatactatttttgatggtttatctgaagatgat
aaggcaaaaacagatattgatgccttatttctgctttctttgttcaatcaaaggtgtgtt
tcgcacttcacagaggctttgagagagttagtgttggaagattcaaatattgtttgctta
ttatcagatagtatcttgcatttcaccaaagccgttgcagacagttttaagcttcctagg
cttgttttaaggactggaggagtttgttcgttattggtttttgctgccatcccacttttg
ataaacaaagcttatttacctcttcaaggtatggaatctgtacaagaggaagcagttgag
gaacttcccccttacagagttaaagatcttcctttattcaagacatgttacgtggatgca
ctttatcaagttattgaaggaatgatacgagaaactaaagcttcatcaggcctcattctc
aattcatttgaacaacttgaacaattctccatatctaaactccgcggtgattttcctatc
ccaatttttccaataggcccctttcactctcattttccggcttcttccagcagcttgatg
tcacaagatcaaacttcaatctcttggctggacacaaaaccacctaaatctgtaatttat
gtcagctttggaagcattgcagcaatagaaattaatgaatttcttgaggttgcttggggt
ttggcaaacagtagtcaccctttcttgtgggtggttaggcccgggttgattcgtggctca
gaatggattgaattgttacctagagagttcttggagagagtggatggaagaggacacatt
gtcaaatgggctcctcagcaacaagtgttggcacatcctgctgttggggcattttggacg
cacagcggatggaattcaacattggagagtatatgtgaaggggtaccaatgatttgtatg
ccatgtttcggtgatcaaatggtgaatgcaaggcatgttagccatgtttggaaagtaggg
gtgcaattagagaatggcttgaagaggacgaacattgagaatgcacttagaacgctgatg
gaggatgaagaagggaaacaaatcaaagaaagaatgttagcgctgaaggagaaggcaaat
ttatgtctaaagccaggaggttcttcttatgagtctctgaggagccttacaagttacatc
tcatcattttga

DBGET integrated database retrieval system