KEGG   Solanum lycopersicum (tomato): 101262269Help
Entry
101262269         CDS       T02665                                 

Definition
NADH--cytochrome b5 reductase 1-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sly00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 278 aa AA seqDB search
MEFLERPDAQLIIGVAVAAVAVGATAYFYFSSKKSKVCLNPEEFRAFKLVKRTQLSHNVA
KFRFELPTPTSVLGLPIGQHISCRGKDSQGEEVVKPYTPTTLDSDIGYFELVIKMYPQGR
MSHHFREMREGDYMEVKGPKGRFKYHPGQVRAFGMLAGGSGITPMFQVARAILENPNDVT
KVHLIYANVTSEDILLKEELEGLTVNYPDRFKVYYVLNQPPEEWSGGVGFVSKEMIQAHC
PAPADDIKILRCGPPPMNKAMAAHLEALGYSPEMQFQF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggagttcttggaaagacctgatgctcaattgattattggggttgctgttgcagctgtt
gctgttggtgctacagcttatttttacttctcttccaagaagtccaaagtatgtttgaac
cctgaagaattcagggcatttaagcttgttaagcgcacacaacttagccataatgtggcg
aaatttagatttgaacttccgacgcccacttctgtgttggggctacccattggacaacat
attagttgcaggggcaaagatagtcaaggtgaagaggttgttaaaccatacacaccaact
actttggactctgacattggatactttgagttagttataaagatgtatccccaaggaagg
atgtcacatcatttccgggaaatgcgcgagggtgattacatggaagtgaagggacccaag
gggcgctttaagtaccatcctggtcaagttagagcatttggaatgcttgcaggaggctct
ggcattaccccgatgttccaggttgctagagctattcttgaaaatcccaacgacgtgacg
aaggtgcacctgatatatgctaatgttacttctgaagatattcttctgaaggaagagttg
gagggccttactgttaactatcctgaccgtttcaaagtttattacgtcttgaatcagcct
cctgaagaatggagtggtggtgtgggatttgtctccaaagaaatgatccaagctcattgc
cctgccccggcagatgatattaagatactgaggtgtggtccaccaccgatgaacaaggca
atggctgctcatcttgaagccctcggatactcaccggagatgcaattccaattctaa

DBGET integrated database retrieval system