KEGG   Solanum lycopersicum (tomato): 101265236Help
Entry
101265236         CDS       T02665                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00220  Arginine biosynthesis
sly00250  Alanine, aspartate and glutamate metabolism
sly00260  Glycine, serine and threonine metabolism
sly00630  Glyoxylate and dicarboxylate metabolism
sly00710  Carbon fixation in photosynthetic organisms
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01200  Carbon metabolism
sly01210  2-Oxocarboxylic acid metabolism
sly01230  Biosynthesis of amino acids
Module
sly_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
sly_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101265236
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101265236
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101265236
   00260 Glycine, serine and threonine metabolism
    101265236
   00220 Arginine biosynthesis
    101265236
Enzymes [BR:sly01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101265236
    2.6.1.4  glycine transaminase
     101265236
    2.6.1.44  alanine---glyoxylate transaminase
     101265236
Amino acid related enzymes [BR:sly01007]
 Aminotransferase (transaminase)
  Class I
   101265236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Exo70
Motif
Other DBs
NCBI-GeneID: 101265236
NCBI-ProteinID: XP_004239121
UniProt: K4BY59
Position
5
AA seq 481 aa AA seqDB search
MSSKALDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVIALCQAPFLLDDPNVGLIFPADAIARAKQFLGMTSGGLGAYSDSRGIPGVRKEVAEFI
ERRDGYPSDPELIFLTDGASKGVMQILNSIIRGPSDGILVPVPQYPLYSASIQLLGGSLV
PYYLEETANWGLDINDLRQSVAQARYKGITVRAMVIINPGNPTGQCLSVANLKQIIQFCH
QENLVLLGDEVYQQNIYQDERPFISARKVLLDMGLPLSKEVQLVSFHTVSKGYWGECGQR
GGYFEMTNIPPKAVEEIYKVASISLSPNVPGQIFMGLMVNPPKPGDISYDQYVRESKGIL
ESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIETANKLGKAPDVLYCLRL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEKYEDHKGYSR
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaaggcattagactatgagaatctgaacgaaaatgtcaagaagtgccaatat
gctgtcagaggtgagctgtaccttcgagcttctgagcttcagaaggaaggcaaaaagatc
atcttcaccaatgttggtaacccccatgcccttgggcagaaaccactgacatttccacgc
caggtcattgctctctgtcaagctccatttttactggatgatccgaatgtgggactcata
ttccctgctgatgcaattgcaagagccaaacagtttcttgggatgacttctggaggtcta
ggtgcttatagtgactcccgaggcattcctggtgtaaggaaagaagttgcagaattcatt
gagagacgtgatggatatccaagtgatccagaactcatatttctcacagatggtgccagc
aaaggagtgatgcagatcttgaacagtatcattcgcggcccaagtgatgggatattggta
cctgttccccagtatccactatactcagcttcaatacaattattggggggttctcttgtt
ccttactaccttgaagagactgcaaactggggtcttgatatcaatgaccttcgccaatca
gttgcacaggcacgatacaagggaataactgtacgagctatggtgattataaaccctgga
aatcccactggacaatgtcttagtgtggcaaatcttaagcaaattattcaattctgtcac
caagaaaatttagtattacttggagacgaagtttatcagcaaaacatttaccaagatgag
cgccccttcataagtgcaagaaaggttttattggatatgggactaccattaagcaaggag
gttcagcttgtctcgtttcacactgtctccaaaggatattggggtgaatgtggacagcgt
ggaggatactttgagatgaccaacattcctcccaaggctgttgaagaaatatacaaggtt
gcttcaatttcactcagtccaaatgtacctggacagatatttatggggctcatggtgaac
ccccctaaacctggagatatctcatatgaccaatatgtcagagagagtaagggtatcctc
gagtcattaaggaagagggcacacatgatgactgatggtttcaacagctgcagaaatgtt
gtttgtaatttcacagaaggtgcaatgtattccttcccgcaaatacgattgcctcctaaa
gcaatagagactgcaaataagcttgggaaagctcctgatgttctctattgtctgaggctg
ttggaagcaactggcatctccaccgtccctggttcaggtttcggtcaaaaggaaggggtg
ttccatctaaggacaaccatcttgccagctgaagaagacatgccagcaataatggaaagt
ttcaaaaagttcaatgatgaattcatggagaaatatgaagaccacaaaggttattccagg
atgtaa

DBGET integrated database retrieval system