KEGG   Solanum lycopersicum (tomato): 101266349Help
Entry
101266349         CDS       T02665                                 

Definition
protein disulfide isomerase-like 2-3-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sly00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101266349
Enzymes [BR:sly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101266349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 432 aa AA seqDB search
MDRASVFPLFLIVLHFIATANALYGPTSPVVQLTESNFKSKVLNSKGIVLVEFFAPWCGH
CQALTPAWEKAATILKGVATVAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGAR
EAKPIAEYALQQIKALLKERIHGKATGGSSESSEPSASVELNSRNFDENVLKSKDLWIVE
FFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVDCDAEKSLMSRYNVQGFPTILVFGADKE
SPVTYEGARTASAIESFGLEQLETNVAPPEVVELTSPDVMEEKCNSAAICFVSFLPDILD
SKAEGRNKYLEMLLAVAEKFKRNPYSFVWVGAGKQPDLEKHVGVGGYGYPAMVALNVKKG
VYAPLKSAFQRQPIIDFVKEAGLGGKGNLPLAATPSIVKSEPWDGKDGEIIEEDEFSLEE
LMGDDTPNKDEL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggatcgagcttcggtttttccacttttcttgattgttctacactttatcgctactgca
aatgcactgtatggacctacatccccagttgttcagttaactgaatccaactttaagtct
aaggtgctaaattcaaaaggtattgttttagttgagttttttgcaccttggtgtggtcat
tgtcaagctctgacacccgcatgggaaaaggcagctaccatattgaaaggtgttgccacg
gttgcagctcttgacgctgatgctcacaaatccctggcgcaggaatatggaatcagagga
tttcctaccatcaaggtgtttgcacctggaaaacctcctgttgattatcaaggggcacgt
gaggctaagccaattgccgaatatgcattgcagcagatcaaagcactgctgaaggagcgg
atacacggaaaagcaacaggaggatcttctgagagttctgagcccagtgcatcagtagag
ttgaattcacgaaattttgatgagaatgttcttaagagcaaagatctctggattgttgag
ttttttgcaccttggtgtgggcactgcaaaaagcttgctcctgagtggaagaaagctgct
aagaaccttcagggtaaggtgaagctgggtcacgtagactgtgatgcggagaagtctttg
atgagcaggtacaatgtccaaggtttccccacaattttggtatttggtgctgacaaggaa
agccctgtcacatacgaaggtgcaaggacagcttcagccatcgagtcctttggattagag
cagctggaaacaaatgttgcacctcctgaagtggttgagttgactagtccagatgtcatg
gaagagaaatgcaactctgctgcaatctgctttgtttcattcctgccggatatattagat
tccaaggctgaaggaaggaacaaatacctagaaatgttgttagccgttgcagagaagttc
aagagaaatccctacagctttgtttgggtgggtgctggtaagcaaccagatcttgaaaag
catgttggtgttggaggttatggatatcccgctatggtagctttgaatgttaaaaaggga
gtatatgcacctcttaagagtgcattccagcgtcagccaataatagactttgtgaaagaa
gctggactcggtggaaaaggtaatcttccattagctgctactccttcgattgtaaagagt
gaaccatgggatggaaaagatggagaaatcatcgaagaagacgagttctcccttgaagaa
cttatgggtgatgacacacctaacaaggatgagttataa

DBGET integrated database retrieval system