KEGG   Solanum lycopersicum (tomato): 101266349Help
Entry
101266349         CDS       T02665                                 

Definition
(RefSeq) protein disulfide isomerase-like 2-3
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sly00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101266349
Enzymes [BR:sly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101266349
Chaperones and folding catalysts [BR:sly03110]
 Protein folding catalysts
  Protein disulfide isomerase
   101266349
Membrane trafficking [BR:sly04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101266349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 OST3_OST6 Thioredoxin_3 Thioredoxin_9 AhpC-TSA ERp29_N
Motif
Other DBs
NCBI-GeneID: 101266349
NCBI-ProteinID: XP_004243508
UniProt: K4CF48
Position
7
AA seq 432 aa AA seqDB search
MDRASVFPLFLIVLHFIATANALYGPTSPVVQLTESNFKSKVLNSKGIVLVEFFAPWCGH
CQALTPAWEKAATILKGVATVAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGAR
EAKPIAEYALQQIKALLKERIHGKATGGSSESSEPSASVELNSRNFDENVLKSKDLWIVE
FFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVDCDAEKSLMSRYNVQGFPTILVFGADKE
SPVTYEGARTASAIESFGLEQLETNVAPPEVVELTSPDVMEEKCNSAAICFVSFLPDILD
SKAEGRNKYLEMLLAVAEKFKRNPYSFVWVGAGKQPDLEKHVGVGGYGYPAMVALNVKKG
VYAPLKSAFQRQPIIDFVKEAGLGGKGNLPLAATPSIVKSEPWDGKDGEIIEEDEFSLEE
LMGDDTPNKDEL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggatcgagcttcggtttttccacttttcttgattgttctacactttatcgctactgca
aatgcactgtatggacctacatccccagttgttcagttaactgaatccaactttaagtct
aaggtgctaaattcaaaaggtattgttttagttgagttttttgcaccttggtgtggtcat
tgtcaagctctgacacccgcatgggaaaaggcagctaccatattgaaaggtgttgccacg
gttgcagctcttgacgctgatgctcacaaatccctggcgcaggaatatggaatcagagga
tttcctaccatcaaggtgtttgcacctggaaaacctcctgttgattatcaaggggcacgt
gaggctaagccaattgccgaatatgcattgcagcagatcaaagcactgctgaaggagcgg
atacacggaaaagcaacaggaggatcttctgagagttctgagcccagtgcatcagtagag
ttgaattcacgaaattttgatgagaatgttcttaagagcaaagatctctggattgttgag
ttttttgcaccttggtgtgggcactgcaaaaagcttgctcctgagtggaagaaagctgct
aagaaccttcagggtaaggtgaagctgggtcacgtagactgtgatgcggagaagtctttg
atgagcaggtacaatgtccaaggtttccccacaattttggtatttggtgctgacaaggaa
agccctgtcacatacgaaggtgcaaggacagcttcagccatcgagtcctttggattagag
cagctggaaacaaatgttgcacctcctgaagtggttgagttgactagtccagatgtcatg
gaagagaaatgcaactctgctgcaatctgctttgtttcattcctgccggatatattagat
tccaaggctgaaggaaggaacaaatacctagaaatgttgttagccgttgcagagaagttc
aagagaaatccctacagctttgtttgggtgggtgctggtaagcaaccagatcttgaaaag
catgttggtgttggaggttatggatatcccgctatggtagctttgaatgttaaaaaggga
gtatatgcacctcttaagagtgcattccagcgtcagccaataatagactttgtgaaagaa
gctggactcggtggaaaaggtaatcttccattagctgctactccttcgattgtaaagagt
gaaccatgggatggaaaagatggagaaatcatcgaagaagacgagttctcccttgaagaa
cttatgggtgatgacacacctaacaaggatgagttataa

DBGET integrated database retrieval system