KEGG   Solanum lycopersicum (tomato): 101266649Help
Entry
101266649         CDS       T02665                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101266649
   00051 Fructose and mannose metabolism
    101266649
Enzymes [BR:sly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     101266649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 481 aa AA seqDB search
MRERNVGKCSLFLLCLNVVSSVVMAAAPPTCPADTGSGCGSDSGEWDGEFFPGIPKIKYE
GPSSKNPLSFKWYNAEEEVLGEKMKDWMRFSVAFWHTFRGTGADPFGAPTKSWPWEDGTN
SLAMAKRRLRANFEFLEKLGVERWCFHDRDIAPEGKTLEETNANLDEVVALAKELQGDKF
HLLWGTAQLFLQPRYMHGAATSSELGVYAYAAAQVKKAMEVTHHLGGENYVFWGGREGYQ
SLLNTDMERELNHMARFMEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLR
KYGLIGEFKLNIECNHATLAGHSCHHELETARINGLLGNIDANSGDPQIGWDTDQFLMDV
AEATLVMQTVIKNGGLAPGGFNFDAKLRRESTDIEDIFIAHIAGMDTLARGLRNAAKLIE
EGSLNDLVRKRYQSFDSELGSAIESGKADFELLEKKALEWGEPKVPSGKQELAEMIFQSA
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaggaatgttgggaagtgttcgttattccttctttgtttgaatgtggtctca
agtgtagtgatggctgctgctccaccaacttgtcctgctgatactggcagcggttgtggg
agtgattcaggtgaatgggatggggagtttttccctggaattccaaaaattaagtatgag
ggtccttctagtaagaacccactctcctttaaatggtacaatgccgaggaggaggttctt
ggagaaaagatgaaggattggatgagatttagcgtagcattttggcatacattccgtggc
acaggagctgatccatttggtgctcctacaaagtcgtggccgtgggaagatggcaccaat
tccctggctatggccaagagaagactgagagccaactttgaattcctggagaaacttgga
gtagaaagatggtgcttccacgatagggacatcgctccagagggaaagacccttgaggaa
acaaatgcaaacttggatgaagtggtggctcttgccaaagagcttcagggagataaattt
catcttctgtggggtaccgctcaattgttcctccagcctcgctacatgcatggtgctgct
actagctctgaattaggtgtatatgcatatgctgctgctcaggtcaagaaagccatggag
gttacacatcatcttgggggagagaattatgtcttttggggtggtcgagaaggttaccag
agcctcctgaacacagatatggaaagagaacttaaccatatggcaaggttcatggaagct
gctgtcgcttacaaaaagaagattggcttcaatggaacattactaattgaaccaaagcct
caggagccaacaaaacaccagtatgactgggatgctgccacttctgctaatttcttacgc
aaatatgggcttataggagagttcaaattgaacatcgagtgcaaccatgccacgttggct
ggtcacagctgccatcatgagcttgaaacagcaagaattaatggtttgctgggcaacatt
gacgcaaattctggcgatccccagattggttgggacacagatcaatttttgatggatgtc
gctgaggcaacattggtgatgcaaaccgttattaaaaatggaggattggcaccaggagga
ttcaactttgatgcaaaattgcgtagggagagcactgatattgaagacatatttattgct
cacattgctggtatggacactctagcccgtggcctcagaaatgctgccaagctaattgag
gagggctcgttgaatgatcttgtcagaaagcgatatcagagttttgactccgaacttggt
tctgcaattgagtctgggaaggcagactttgaactgctcgagaagaaggcgctagaatgg
ggagaacctaaagttccttctggaaagcaggagcttgcagagatgatttttcagtcagca
ttgtag

DBGET integrated database retrieval system