KEGG   Solanum lycopersicum (tomato): 101267342Help
Entry
101267342         CDS       T02665                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101267342
Peptidases [BR:sly01002]
 Cysteine Peptidases
  Family C86
   101267342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 179 aa AA seqDB search
MDDEKVEIYHERQRLQFCLLHSLNNLFQEKDAFTRSDLNKVAEKLDVDDPNRRSWNPVSL
VFRPHHNEITGNYDINVLIAALQQKAKTVVWHDKRNVASSIDLDDPLMGIVLNVPVTKFS
GLWKSRHWVTLRCIQGVWYNLDSDFAAPYAFKDTQQLREFLDRIITAGAEVLLVMNDKR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgagaaagtagaaatatatcacgagaggcaaagattacagttttgcctctta
cattctctcaataatctcttccaggaaaaagatgcatttacaagatctgatttaaataaa
gttgctgagaaacttgatgtggatgaccctaacaggagaagctggaatcctgtatcactt
gtatttagacctcatcataacgaaatcaccggtaactatgatatcaatgtattgattgca
gcgctccagcagaaagctaaaactgttgtttggcatgataagcgaaatgtggcttcttca
attgaccttgatgatccgctcatgggaattgttcttaatgttcctgttacaaagtttagt
ggcctttggaaaagcaggcattgggttacgttaagatgtattcagggggtttggtataat
ctagacagtgattttgctgctccttatgcttttaaagatacccaacaacttagggagttc
ttggatcgtatcattactgctggtgcggaggttttactcgtcatgaatgataaacgatga

DBGET integrated database retrieval system