KEGG   Solanum lycopersicum (tomato): 3950460Help
Entry
3950460           CDS       T02665                                 

Gene name
rbcL, LyesC2p061
Definition
ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    3950460 (rbcL)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    3950460 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    3950460 (rbcL)
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     3950460 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
CP
AA seq 477 aa AA seqDB search
MSPQTETKASVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQTETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDFVEQDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVKARNEGRDLAREGNEIIREACKWSPELAAACEVWKEIVFNFAAVDVLDK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagagtac
aaattgacttattatactcctgagtaccaaaccaaggatactgatatattagcagcattc
cgagtaactcctcaacctggagttccacctgaagaagcaggggccgcggtagctgccgaa
tcttctactggtacatggacaactgtatggaccgatggacttaccagtcttgatcgttac
aaagggcgatgctaccgcatcgagcgcgttgttggagaaaaagatcaatatattgcttat
gtagcttaccctttagacctttttgaagaaggttccgttaccaatatgtttacttccatt
gtaggtaacgtatttgggttcaaagccctgcgcgctctacgtctggaagatctgcgaatc
cctcctgcttatgttaaaactttccaaggtccgcctcatgggatccaagttgaaagagat
aaattgaacaagtatggtcgtcccctgttgggatgtactattaaacctaaattggggtta
tctgcaaaaaactacggtagagctgtttatgaatgtcttcgcggtggacttgattttacc
aaagatgatgagaacgtgaactcacaaccatttatgcgttggagagatcgtttcttattt
tgtgccgaagcactttttaaagcacagactgaaacaggtgaaatcaaagggcattacttg
aatgctactgcaggtacatgcgaagaaatgatcaaaagagctgtatttgctagagaattg
ggcgttccgatcgtaatgcatgactacttaacggggggatttaccgcaaatactaccttg
gctcattattgccgagataatggtctacttcttcacatccaccgtgcaatgcatgcggtt
attgatagacagaagaatcatggtatccacttccgggtattagcaaaagcgttacgtatg
tctggtggagatcatattcactctggtaccgtagtaggtaaacttgaaggtgaaagagac
ataactttgggctttgttgatttactgcgtgatgattttgttgaacaagatagaagtcgc
ggtatttatttcactcaagattgggtctctttaccaggtgttctacctgtggcttcagga
ggtattcacgtttggcatatgcctgctctgaccgagatctttggggatgattccgtacta
cagttcggtggaggaactttaggacatccttggggtaatgcgccaggtgccgtagctaat
cgagtagctctagaagcatgtgtaaaagctcgtaatgaaggacgtgatcttgctcgggaa
ggtaatgagattattcgcgaggcttgcaaatggagcccggaactagctgctgcttgtgag
gtatggaaagagatcgtatttaattttgcagcagtggacgttttggataagtaa

DBGET integrated database retrieval system