KEGG   Solanum lycopersicum (tomato): 543502Help
Entry
543502            CDS       T02665                                 

Gene name
Wiv-1, LIN6
Definition
(RefSeq) acid invertase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    543502 (Wiv-1)
   00500 Starch and sucrose metabolism
    543502 (Wiv-1)
Enzymes [BR:sly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     543502 (Wiv-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
10
AA seq 582 aa AA seqDB search
MEILRKSSSLWALPILVLCFFINNGVFVDASHKVYMHLQSTTSHVDASKVHRTGYHFQPP
KNWINDPNGPMYYNGVYHLFYQYNPKGATWGNIVWAHSVSKDLINWIPLEPAIYPSKVFD
KYGTWSGSATILPGNKPVILYTGIVDANKTQVQNYAIPANMSDPYLRKWIKPDNNPLIVA
DKNINKIQFRDPTTAWMGRDGYWRVLVGSVRNHRGKVIMYKSNKNFMKWTKAKHPLHSAQ
GTGNWECPDFFPVSLKNENGLDTSYDGKDVKHVLKVSFDVTRFDHYTVGTYDTKKDKYFP
DNTSIDGWKGLRLDYGNYYASKTFFDSGKNRRILLGWANESDTVDNDVKKGWAGVHPIPR
KIWLDPSGKQLVQWPVQELETLRKKKVQLNNKKLNKGEKVEIKGITVAQADVEVIFSFAS
LDKAEPFDSSWADLYAQDVCAIKGSTVQGGLGPFGLLTLASKNLEEYTPVFFRVFKAHDN
YKVLMCSDASRSSLKNETTMYKPSFAGYVDVDLADKKLSLRSLIDNSIVESFGAGGKTCI
TSRVYPTLAIFDKAHLFAFNNGAETITIETLNAWSMANAKLH
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggagattttaagaaaatcttcttctctttgggctttgccaattcttgtgttgtgtttc
tttatcaacaatggagtatttgttgatgcttctcacaaagtttatatgcacttgcaatct
actactagtcatgttgatgctagcaaggtccatagaactggttatcattttcaacctcct
aaaaattggattaacgatccaaatggtccaatgtattacaacggagtgtaccatctattt
taccagtacaacccaaaaggagcaacatggggcaacattgtttgggctcattcagtctca
aaggacttgatcaactggatcccgctcgaacccgctatctacccgtctaaagtatttgac
aagtacggtacatggtccgggtcagccacaatcttaccaggcaacaagcctgtgatcctc
tacactggaattgtggatgctaacaaaacacaagtccaaaactacgcaattccagctaac
atgtctgatccatatcttcgtaagtggatcaagcccgataacaatccattgattgtcgcg
gacaaaaacataaataaaatccaatttcgcgatccaacaacagcttggatgggcagagat
ggatactggagagtattggttgggagtgtgaggaatcacaggggaaaagttataatgtac
aagagtaataagaacttcatgaaatggacaaaagctaaacacccactccactcagctcag
ggtactgggaattgggaatgtcctgatttttttccagtgtcattgaaaaatgaaaatggt
ttggacacgtcgtacgatggaaaagatgttaaacatgttcttaaagttagctttgatgtt
acgaggtttgatcactatacagttggtacgtacgacaccaaaaaggataagtactttccg
gataacacttctattgatggatggaaaggattgagacttgattacggtaattattacgcg
tccaagacgttctttgatagtggcaagaatcgtaggattttattgggttgggctaatgaa
tcagatactgttgataacgatgtgaaaaaaggatgggccggggttcaccctattcctcgt
aaaatatggcttgatcctagtgggaaacaattggttcaatggcctgttcaagaattagaa
acactaagaaagaaaaaggttcaattaaataacaaaaaattgaacaagggagaaaaggtt
gaaatcaaaggaatcacagttgcacaggctgacgttgaagtgatattctcattcgcgagt
ttagacaaggcagagccatttgattctagttgggctgatctttatgcgcaagatgtatgc
gccattaaaggttcaacggttcaaggtggtcttgggccttttgggcttctaactttggct
tctaaaaacttagaagaatacacacccgttttcttcagagttttcaaggctcatgataat
tacaaggttctcatgtgttccgatgcctcaaggtcaagcctaaagaatgaaactactatg
tataaaccatcatttgctggatacgtagatgtagatttagcagacaagaaattgtctctt
agaagtttgattgataattcgatagtggaaagttttggtgctggaggaaaaacgtgcatt
acatcaagggtttatccaacgttggcgatatttgataaagcacatttattcgccttcaac
aatggcgcagagacgatcacaattgagactctaaatgcttggagcatggctaatgctaag
ttgcactag

DBGET integrated database retrieval system