KEGG   Solanum lycopersicum (tomato): 543713Help
Entry
543713            CDS       T02665                                 

Gene name
LIN7
Definition
(RefSeq) cell-wall invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00052  Galactose metabolism
sly00500  Starch and sucrose metabolism
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    543713 (LIN7)
   00500 Starch and sucrose metabolism
    543713 (LIN7)
Enzymes [BR:sly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     543713 (LIN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 543713
NCBI-ProteinID: NP_001234701
UniProt: Q8L4N2
Position
9
AA seq 583 aa AA seqDB search
MDYSSNKSSRWALPVILVCFFVILLSNNVVFASHKVFIHLQSQNAVNVHTVHRTGYHFQP
EKHWINDPNAPMYFNGVYHLFYQYNPNGSVWGNIVWAHSVSKDLINWINLEPAIYPSKPF
DQFGTWSGSATILPGNKPVILYTGIIDANQTQVQNYAIPANLSDPYLREWIKPDNNPLII
ADESINKTKFRDPTTAWMGKDGHWRIVMGSLRKHSRGLAIMYRSKDFMKWVKAKHPLHST
NGTGNWECPDFYPVSSKGTDGLDQYGEEHKYVLKNSMDLTRFEYYTLGKYDTKKDRYVPD
PDSVDSLKGLRLDYGNFYASKSFYDPSKNRRVIWGWSNESDIFPEDDNAKGWAGIQLIPR
KVWLDPSGKQLVQWPVEELETLRTQKVQLSNKKMNNGEKIEVTGITPAQADVEVTFSFAS
LDKAESFDPKWNDMYAQDVCGLKGADVQGGLGPFGLATLATENLEENTPVFFRVFKAQQN
YKVLLCSDAKRSTLKFNETMYKASFAGFVDVDLADKKLSLRSLIDNSVIETFGAGGKTCI
TSRVYPTLAINDEAHLFAFNNGTEPITIESLDAWSMGKAKIQY
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggattattcatctaataaaagttctcgttgggctttgccagttatcttagtttgcttt
tttgtaattttattatccaataatgttgtttttgcttctcataaagtttttattcacttg
caatctcaaaatgctgtaaatgttcatactgttcatcgaactggttatcattttcagccc
gaaaaacattggatcaatgatcccaatgcaccaatgtatttcaatggagtgtatcatcta
ttctaccagtacaacccaaatggttcagtatggggtaacattgtttgggctcattccgtt
tcaaaagacttgatcaattggatcaatttagaacctgcaatttacccatcaaagccattt
gatcaattcggtacctggtctggatcagcaaccatcctacctggtaacaagccagtcatc
ttgtacaccggaatcatagatgccaaccaaacccaagtccaaaactacgcaatcccagct
aacttatccgatccatatctccgcgaatggatcaagccagacaacaacccattaattata
gccgatgaaagtatcaacaagaccaagtttcgtgacccaacaacagcatggatgggtaaa
gacgggcattggagaatcgtcatgggaagtttgaggaaacacagcaggggcttagctata
atgtataggagcaaagactttatgaaatgggtcaaggctaaacacccacttcactcaact
aacggcactggaaactgggaatgccctgatttttacccagtttcatcgaaaggtactgat
gggttggatcaatacggtgaggaacacaagtacgtgctgaagaacagtatggatcttact
cgatttgagtattatacacttggaaaatacgatacgaaaaaagataggtacgttccagat
ccagattctgtcgatagtttgaagggattgagactcgattacggtaacttctacgcatcg
aagtcattctacgatccaagcaaaaatcgaagggttatctggggttggtctaatgaatca
gatatattcccagaggatgataatgcgaagggatgggctgggattcaattgattcctcgt
aaagtatggcttgatccaagtggtaagcagttggttcaatggcctgtggaggaactagaa
accctaagaactcaaaaggttcaattgagcaacaagaagatgaacaatggggagaagatt
gaagttacaggaatcacaccagcacaggctgatgttgaagtgacattctcatttgcaagt
ttggataaggcagagtcatttgatcctaaatggaatgatatgtatgcacaagatgtttgt
ggactcaagggtgcagatgttcaaggtgggcttgggccatttggtcttgctacattagct
actgaaaacttggaagaaaacacaccggttttcttccgagttttcaaagcacagcaaaac
tacaaggttctcttgtgttctgacgctaaaaggtcaactcttaagttcaatgaaacaatg
tacaaagcttcatttgctggatttgttgatgttgatttggctgacaagaaattgtcactc
agaagcttgattgataattcagttatagaaacttttggtgctggtggaaagacatgtata
acatcgagggtttatccaacattggcaattaacgacgaggcacatttattcgcgtttaac
aacggaacggagccaatcacaattgagagtttggatgcatggagtatgggcaaagctaag
atacaatattga

DBGET integrated database retrieval system