KEGG   Solanum lycopersicum (tomato): 543715Help
Entry
543715            CDS       T02665                                 

Definition
TK1-like deoxyribonucleoside kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    543715
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     543715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 234 aa AA seqDB search
MAFSSSARNPVDLRNGSKNSFCPVGEIHVIVGPMFAGKTTALLRRVNLESNDGRNVVLIK
SSKDARYAVDAVVTHDGTRFPCWSLPDLSSFKQRFGKDAYEKVDVIGIDEAQFFGDLYEF
CCNAADFDGKIIVVAGLDGDYLRKSFGSVLDIIPLADTVTKLTARCELCNRRAFFTFRKT
NETETELIGGADIYMPVCRQHYVNGQSVNESAKMVLESHKVSNELILESPLVDP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggctttttcatcatctgctagaaacccagttgacctgagaaatggatcgaagaacagt
ttttgtccggtgggtgaaatacatgtaattgttggtcctatgtttgctggaaaaaccact
gctcttcttcgccgggtcaatttggaatccaacgatgggagaaatgtggtactgattaag
tcaagtaaagatgcaagatatgctgtagatgcagtggtgacacatgatgggacaagattt
ccatgttggtcattgccggatctttcatctttcaagcagagatttggaaaagatgcatat
gaaaaggtggatgtgattggcatcgatgaagctcagttctttggggacctttatgagttc
tgctgcaatgctgctgattttgatgggaaaattatagttgttgcaggcctagatggtgat
tacttgaggaagagttttggttcagtgcttgacataattccacttgctgatactgtgacc
aagttgactgctagatgtgagttgtgtaacagaagggcatttttcaccttcagaaagact
aatgagacagagactgagcttataggaggtgctgatatttacatgcctgtttgtcgtcag
cactatgttaatggacaatctgtcaatgaatctgcaaaaatggttcttgaatctcataaa
gtgtcaaatgaacttatcttagaatcaccactagttgatccataa

DBGET integrated database retrieval system