KEGG   Solanum lycopersicum (tomato): 543792Help
Entry
543792            CDS       T02665                                 

Gene name
mpka1;1, MPK1
Definition
Mitogen-activated protein kinase
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Plant hormone signal transduction
Class
Environmental Information Processing; Signal transduction; Plant hormone signal transduction [PATH:sly04075]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 396 aa AA seqDB search
MDGSVPQTDTMMSDVAAPPAQQPPPPSQPLAGMDNIPATLSHGGRFIQYNIFGNIFEVTA
KYKPPIMPIGKGAYGIVCSALNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHE
NIVAIRDIIPPPQREAFNDVYIAYELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYI
HSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRGPELLLNSSD
YTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIR
QLPLYRRQSFTEKFPHVNPAAIDLVEKMLTFDPRRRITVEDALAHPYLTSLHDISDEPIC
MTPFSFDFEQHALTEEQMKELIYRESIAFNPEYQRM
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggatggttccgttccgcaaacggatacgatgatgtcggatgtggctgcacctccggct
caacaaccacctccgccgtcacaaccgctggctggaatggataatattccggcgacgtta
agccatggtggcaggttcattcaatacaatatttttggtaatatttttgaagttactgct
aagtataaacctcctataatgccaattggtaaaggtgcttatggaatcgtttgttctgct
ttgaattcggagacaaatgaatctgtagcaattaagaaaattgctaatgcttttgataac
aagattgatgctaagaggactttgagagagatcaagcttcttcgacatatggatcatgaa
aatattgttgcgatcagagatataattccaccaccacagagagaagcctttaacgatgtt
tacattgcgtatgagcttatggatactgacctgcatcaaattattcgctcgaatcagggt
ttatctgaggagcactgccagtatttcttgtatcagatcctccgtgggttgaaatacata
cattctgcaaatgttttgcacagagacttaaagcctagcaatcttctcttgaatgccaac
tgtgatttgaagatatgtgattttgggctagctcgtgtcacttctgaaactgactttatg
accgaatatgttgtgacaagatggtatcgtggacctgagctgttgttgaattcatccgac
tatactgcagcaattgatgtatggtcagtgggttgcatcttcatggagttgatggacaga
aaacccctcttccctggcagagatcatgtacaccagctgcgtcttattatggagttgatt
ggcactccttcagaggctgaaatggaatttttaaatgagaatgcaaaacgctatatccga
caacttcctctttaccgtcgacaatcatttactgaaaagttcccgcatgtaaacccagct
gctattgatcttgtcgagaaaatgttgacatttgatcccagaaggagaataacagttgaa
gacgctcttgcacatccttacctaacatcgctccatgatatcagtgacgagcccatttgc
atgactccttttagcttcgactttgagcagcatgcgcttacagaggaacagatgaaggag
ctaatttacagggagtcgattgcatttaatcctgaataccagcgcatgtga

DBGET integrated database retrieval system