KEGG   Solanum lycopersicum (tomato): 543792Help
Entry
543792            CDS       T02665                                 

Gene name
mpka1;1, MPK1
Definition
Mitogen-activated protein kinase
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:sly00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    543792 (mpka1;1)
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     543792 (mpka1;1)
Protein kinases [BR:sly01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   543792 (mpka1;1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 396 aa AA seqDB search
MDGSVPQTDTMMSDVAAPPAQQPPPPSQPLAGMDNIPATLSHGGRFIQYNIFGNIFEVTA
KYKPPIMPIGKGAYGIVCSALNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHE
NIVAIRDIIPPPQREAFNDVYIAYELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYI
HSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRGPELLLNSSD
YTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIR
QLPLYRRQSFTEKFPHVNPAAIDLVEKMLTFDPRRRITVEDALAHPYLTSLHDISDEPIC
MTPFSFDFEQHALTEEQMKELIYRESIAFNPEYQRM
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggatggttccgttccgcaaacggatacgatgatgtcggatgtggctgcacctccggct
caacaaccacctccgccgtcacaaccgctggctggaatggataatattccggcgacgtta
agccatggtggcaggttcattcaatacaatatttttggtaatatttttgaagttactgct
aagtataaacctcctataatgccaattggtaaaggtgcttatggaatcgtttgttctgct
ttgaattcggagacaaatgaatctgtagcaattaagaaaattgctaatgcttttgataac
aagattgatgctaagaggactttgagagagatcaagcttcttcgacatatggatcatgaa
aatattgttgcgatcagagatataattccaccaccacagagagaagcctttaacgatgtt
tacattgcgtatgagcttatggatactgacctgcatcaaattattcgctcgaatcagggt
ttatctgaggagcactgccagtatttcttgtatcagatcctccgtgggttgaaatacata
cattctgcaaatgttttgcacagagacttaaagcctagcaatcttctcttgaatgccaac
tgtgatttgaagatatgtgattttgggctagctcgtgtcacttctgaaactgactttatg
accgaatatgttgtgacaagatggtatcgtggacctgagctgttgttgaattcatccgac
tatactgcagcaattgatgtatggtcagtgggttgcatcttcatggagttgatggacaga
aaacccctcttccctggcagagatcatgtacaccagctgcgtcttattatggagttgatt
ggcactccttcagaggctgaaatggaatttttaaatgagaatgcaaaacgctatatccga
caacttcctctttaccgtcgacaatcatttactgaaaagttcccgcatgtaaacccagct
gctattgatcttgtcgagaaaatgttgacatttgatcccagaaggagaataacagttgaa
gacgctcttgcacatccttacctaacatcgctccatgatatcagtgacgagcccatttgc
atgactccttttagcttcgactttgagcagcatgcgcttacagaggaacagatgaaggag
ctaatttacagggagtcgattgcatttaatcctgaataccagcgcatgtga

DBGET integrated database retrieval system