KEGG   Solanum lycopersicum (tomato): 543879Help
Entry
543879            CDS       T02665                                 

Gene name
MPK2, LeMPK2
Definition
mitogen-activated protein kinase 2
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:sly00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    543879 (MPK2)
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     543879 (MPK2)
Protein kinases [BR:sly01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   543879 (MPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 394 aa AA seqDB search
MDGSAPQTDTVMSDAAAGQQPAMPPLPMAGMENIPATLSHGGRFIQYNIFGNIFEVTAKY
KPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENI
VAIRDIIPPPQREAFNDVYIAYELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYIHS
ANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYT
AAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKRYIRQL
PLYRRQSFVEKFPHVNPAAIDLVEKMLTFDPRRRLTVEDALAHPYLTSLHDISDEPVCMT
PFSFDFEQHALTEEQMKELIYREGLAFNPEYQHM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggatggttcagctccgcaaacggatacggtgatgtcggatgcggcggcgggacagcaa
cctgctatgccgccgctgccgatggccggaatggagaatattcctgcaacgttgagtcac
ggtggccggtttattcaatacaatatttttggtaatatatttgaagttactgcgaagtat
aagcctccaattatgccaatcggtaaaggagcttatggtattgtttgttctgctttgaat
tcggagacgaatgaacatgttgcaataaagaaaattgcaaatgcttttgataacaaaatt
gatgccaagagaactttgcgtgagatcaagcttcttcgacatatggatcatgaaaatatt
gttgcgattagagatataattccaccacctcaacgagaagcatttaatgatgtctatatt
gcatatgagcttatggacactgatctccatcaaattattcgctctaatcagggattatca
gaagaacattgccagtatttcttgtatcagatcctccgtggattgaaatacatacattct
gcaaatgtgttgcatagggacttgaagcctagcaatctcctcttgaatgccaattgtgat
ttaaagatatgtgattttgggctagctcgtgtcacttctgaaactgactttatgaccgaa
tatgttgtgacaagatggtaccgacctccagagctgttgttaaattcttctgactatact
gcagctattgatgtttggtcagttggttgcattttcatggaactgatggacagaaagcct
ctgtttcctggtagagatcatgtacaccagctacgtctgcttatggagttgattggcacc
ccgtctgaggctgaaatggagtttttgaatgagaatgcaaagcggtatatcagacaactt
cctctttaccgtcgacaatcatttgtcgaaaaatttccacatgtaaaccctgctgctatt
gatcttgttgagaaaatgttgacatttgatcccagaaggagacttactgttgaagacgcg
cttgctcatccttacctaacatcgcttcatgatattagtgacgagcccgtttgcatgact
ccttttagcttcgattttgaacagcatgcccttaccgaggaacaaatgaaagagctgatt
tacagggagggtcttgcatttaatcccgaataccagcacatgtga

DBGET integrated database retrieval system