KEGG   Solanum lycopersicum (tomato): 543880Help
Entry
543880            CDS       T02665                                 

Gene name
MPK3, LeMPK3, MAPK3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K20536  mitogen-activated protein kinase 3 [EC:2.7.11.24]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:sly00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    543880 (MPK3)
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     543880 (MPK3)
Protein kinases [BR:sly01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   543880 (MPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 543880
NCBI-ProteinID: NP_001234360
UniProt: Q84MI4
Position
6
AA seq 373 aa AA seqDB search
MVDANMGAAQFPDFPKIVTHAGQYVQYDIFGNLFEITNKYQPPIMPIGRGAYGIVCSVFN
AELNEMVAVKKIANAFDNYMDAKRTLREIKLLRHLDHENVIGLRDVIPPPLRREFSDVYI
ATELMDTDLHQIIRSNQGLSEDHCQYFMYQLLRGLKYIHSAHVIHRDLKPSNLLLNANCD
LKICDFGLARPNVENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKP
LFAGKDHVHQIRLLTELLGTPTESDLSFLRNEDAKRYVRQLPQHPRQQLATVFPHVNPLA
IDLVDKMLTLDPTRRITVEEALAHPYLAKLHDAADEPVCPIPFSFDFEQQGIGEEQIKDM
IYQEALALNPEYA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgctaatatgggtgctgctcaatttcctgattttcctaaaattgtcactcat
gctggacaatatgttcagtatgacatttttggtaatctttttgagattactaacaagtat
caacctcctatcatgcctattggacgtggcgcttatggaatcgtctgctctgtgtttaat
gcggagctgaatgagatggttgcagttaagaaaatcgccaatgcttttgataattacatg
gatgctaagaggacgctccgtgaaattaagcttcttcgccatttagaccatgaaaacgtc
attggtttaagagatgtgattcctccgcccttacgaagggagttttctgatgtttacatt
gctactgaactcatggatactgatcttcaccaaataattagatcaaaccaaggtttatca
gaggatcattgccagtacttcatgtatcagcttctccgtgggctaaagtacatacattcc
gcgcatgttattcatagagatctcaaaccaagtaacctcttgctaaatgcaaattgtgat
cttaagatatgtgattttggtcttgcaaggccaaacgtagagaacgagaatatgacagaa
tatgtagtaaccagatggtacagagcaccggagcttttgttgaactcttcagattacact
gctgccatagatgtttggtctgtgggttgcatcttcatggagcttatgaatagaaaacct
ttgtttgctggaaaagatcatgtacatcaaattcgcttgctaactgagcttcttggcact
cctacagaatctgatcttagcttcctccgtaatgaagatgcaaaaagatacgtcaggcaa
ctcccacaacatccacgccagcagttagcaacagtgttccctcatgtgaatccattagcc
attgatcttgtagataagatgttgacgctcgaccctactagaagaataacagttgaggaa
gcattagctcatccctacctcgcaaagctccatgatgcagctgatgaaccagtctgcccc
atcccgttctctttcgactttgagcaacaagggataggagaagagcagattaaagacatg
atttatcaagaagctttggcgttgaatcctgaatatgcttaa

DBGET integrated database retrieval system