KEGG   Solanum lycopersicum (tomato): 544016Help
Entry
544016            CDS       T02665                                 

Gene name
PMEU1
Definition
pectin methylesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sly00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sly00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 583 aa AA seqDB search
MTRVEDFFSKQIDFCKRKKKIYLAIVASVLLVAAVIGVVAGVKSHSKNSDDHADIMAISS
SAHAIVKSACSNTLHPELCYSAIVNVSDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKE
LIKTRKGLTPREKVALHDCLETMDETLDELHTAVEDLELYPNKKSLKEHVEDLKTLISSA
ITNQETCLDGFSHDEADKKVRKVLLKGQKHVEKMCSNALAMICNMTDTDIANEMKLSAPA
NNRKLVEDNGEWPEWLSAGDRRLLQSSTVTPDVVVAADGSGDYKTVSEAVRKAPEKSSKR
YVIRIKAGVYRENVDVPKKKTNIMFMGDGKSNTIITASRNVQDGSTTFHSATVVRVAGKV
LARDITFQNTAGASKHQAVALCVGSDLSAFYRCDMLAYQDTLYVHSNRQFFVQCLVAGTV
DFIFGNGAAVFQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLRPVQ
KSFPTYLGRPWKEYSRTVIMQSSITDVIQPAGWHEWNGNFALDTLFYGEYANTGAGAPTS
GRVKWKGHKVITSSTEAQAYTPGRFIAGGSWLSSTGFPFSLGL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtgttgaagattttttcagcaaacaaatcgatttttgtaaaaggaagaaaaaa
atctacttggccattgttgcctcagtcctgctggttgctgcagtaatcggagtagtcgcc
ggagtaaaatctcattcgaaaaactccgacgatcatgcagacataatggccatttcgtct
tcagcccatgctattgtaaaatctgcgtgtagcaacactctacaccccgaactgtgttac
tctgcgattgtcaatgtttctgatttctcaaaaaaagtaacaagccaaaaagatgtgatt
gaattgtccttgaatatcactgtcaaagccgttcgacgcaactactatgcagtcaaggaa
ctcatcaaaactagaaaaggtttaaccccacgagaaaaggttgcgctgcatgactgcctg
gagacgatggacgagacactcgacgagctccacactgctgtagaagatctggagctatat
cccaacaaaaaatcattgaaagaacacgtcgaagacctgaaaactctaataagttccgca
attacaaaccaggaaacttgcctcgacggtttctctcacgatgaggccgataaaaaggta
cgcaaggttttgttgaaaggccaaaagcacgtggaaaaaatgtgcagcaatgctttagct
atgatctgtaacatgaccgataccgacattgcaaatgagatgaaattatcggcccccgcc
aataataggaagttagtagaggataacggcgagtggccggagtggttgtccgccggcgac
aggaggttattgcagtcgtcgacggtgacgccagatgtggttgtggcggccgacggaagc
ggagattacaaaacggtgtcagaggcggtacgaaaagcgccagagaagagtagcaagagg
tatgtgattaggataaaagctggtgtttacagggaaaacgtggatgtgccaaagaagaag
acgaatattatgtttatgggagatggcaaaagcaatacaataatcacagcaagtaggaat
gtgcaagatggtagcactaccttccactctgctacagttgtccgcgtggcaggaaaagtt
cttgcccgggatataaccttccaaaacacagcaggagcctcgaagcatcaagccgtggca
ctctgcgtgggctctgatttgtccgcattttatagatgtgacatgttggcttatcaggac
accctctacgtccactctaatcgtcaattctttgtacaatgtttagtcgctggtaccgtt
gattttatattcgggaatggtgctgctgtttttcaagactgtgatattcacgccaggcgt
cctggttcgggccagaagaacatggttactgctcaaggaagaactgaccctaaccagaat
actggtattgttatccagaaatgtagaattggtgcaacgtctgatttgagaccggtgcag
aagagtttccctacatatctaggaaggccgtggaaagaatattcgaggacagtgatcatg
caatcgtcgattactgatgtgatccagcctgctggatggcatgaatggaatgggaatttt
gcattggatactctgttttatggggagtatgcaaatacaggggcaggagcaccgacgtca
ggaagagttaaatggaaagggcacaaggtaattacaagttcaactgaggcccaagcttat
actcctggcaggttcattgctggaggtagttggttgagctccacaggcttccctttttct
cttggtctttaa

DBGET integrated database retrieval system