KEGG   Solanum lycopersicum (tomato): 544150Help
Entry
544150            CDS       T02665                                 

Gene name
DFR
Definition
dihydroflavonol 4-reductase (EC:1.1.1.219)
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:sly00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 379 aa AA seqDB search
MASEAHAVVDAHSPPKTTTVWVTGGAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHL
LELPKADTNLTLWKADLAVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGML
SIIESCAKANTVKRLVFTSSAGTLDVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKI
LAEKAAMEEARKNNIDFISIIPPLVVGPFITSTFPPSLITALSLITAHYGIIKQGQYVHL
DDLCEAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLALVS
FSSKKLMDIKFQFKHTLEDMYKGAIETCRQKQLLPFSTRSTADNGKDKEAIPISTENYSS
GKENAPVANCTGKFTNGEI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgaagctcatgcagttgttgatgcccactctcctccgaagacgacaacggtt
tgggtcacaggaggagctggatttatcggctcttggcttgtcatgagactccttgaacgc
ggttataatgtccacgctactgttcgtgatcctgagaaccagaagaaggtgaaacatctg
ttggaattgccaaaagctgatacaaacttaacgctgtggaaagctgacttggcagtggaa
ggaagctttgatgaagccattcaaggctgtcaaggagtatttcatgtggctacacccatg
gatttcgagtccaaggatccagagaacgaagtaatcaaaccaacagtcaggggaatgtta
agtatcatagaatcatgtgctaaagctaacacagtgaagaggctggttttcacttcatct
gctggaactcttgatgtccaagaggaccaaaaactcttctatgacgagaccagctggagc
gatttggacttcatatatgctaagaagatgacaggctggatgtattttgtttccaagata
ctggcagagaaggctgcaatggaagaagctagaaagaataacattgatttcattagcatc
ataccaccactggttgttggtccattcatcacatctacgttcccaccaagcttaatcact
gccctttcactaattaccgctcactacggcatcattaaacaaggtcaatatgtgcatttg
gatgatctttgtgaggctcatatattcctgtatgagcaccccaaggcagagggaagattc
atttgctcatcccatcatgctatcatctacgatgtggctaagatggtgcgacagaaatgg
ccagagtactatgttcctactgagtttaagggtatcgataaggacttggccctagtgtct
ttttcatcaaagaagcttatggatataaaatttcaattcaaacacactttggaggatatg
tataaaggggccattgagacttgccgacagaagcaattgcttcccttttctacccgaagc
actgcagacaatggaaaagacaaagaagcaattcccatttctactgaaaactattcaagt
ggcaaggagaatgcaccagttgccaattgtacagggaagtttaccaatggtgaaatctag

DBGET integrated database retrieval system