KEGG   Solanum lycopersicum (tomato): 544150Help
Entry
544150            CDS       T02665                                 

Gene name
DFR, FNR
Definition
(RefSeq) dihydroflavonol 4-reductase
  KO
K13082  bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00941  Flavonoid biosynthesis
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Module
sly_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    544150 (DFR)
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     544150 (DFR)
    1.1.1.234  flavanone 4-reductase
     544150 (DFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 NmrA KR adh_short Polysacc_synt_2 RmlD_sub_bind ApbA F420_oxidored
Motif
Other DBs
NCBI-GeneID: 544150
NCBI-ProteinID: NP_001234408
UniProt: P51107
Position
2
AA seq 379 aa AA seqDB search
MASEAHAVVDAHSPPKTTTVWVTGGAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHL
LELPKADTNLTLWKADLAVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGML
SIIESCAKANTVKRLVFTSSAGTLDVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKI
LAEKAAMEEARKNNIDFISIIPPLVVGPFITSTFPPSLITALSLITAHYGIIKQGQYVHL
DDLCEAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLALVS
FSSKKLMDIKFQFKHTLEDMYKGAIETCRQKQLLPFSTRSTADNGKDKEAIPISTENYSS
GKENAPVANCTGKFTNGEI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgaagctcatgcagttgttgatgcccactctcctccgaagacgacaacggtt
tgggtcacaggaggagctggatttatcggctcttggcttgtcatgagactccttgaacgc
ggttataatgtccacgctactgttcgtgatcctgagaaccagaagaaggtgaaacatctg
ttggaattgccaaaagctgatacaaacttaacgctgtggaaagctgacttggcagtggaa
ggaagctttgatgaagccattcaaggctgtcaaggagtatttcatgtggctacacccatg
gatttcgagtccaaggatccagagaacgaagtaatcaaaccaacagtcaggggaatgtta
agtatcatagaatcatgtgctaaagctaacacagtgaagaggctggttttcacttcatct
gctggaactcttgatgtccaagaggaccaaaaactcttctatgacgagaccagctggagc
gatttggacttcatatatgctaagaagatgacaggctggatgtattttgtttccaagata
ctggcagagaaggctgcaatggaagaagctagaaagaataacattgatttcattagcatc
ataccaccactggttgttggtccattcatcacatctacgttcccaccaagcttaatcact
gccctttcactaattaccgctcactacggcatcattaaacaaggtcaatatgtgcatttg
gatgatctttgtgaggctcatatattcctgtatgagcaccccaaggcagagggaagattc
atttgctcatcccatcatgctatcatctacgatgtggctaagatggtgcgacagaaatgg
ccagagtactatgttcctactgagtttaagggtatcgataaggacttggccctagtgtct
ttttcatcaaagaagcttatggatataaaatttcaattcaaacacactttggaggatatg
tataaaggggccattgagacttgccgacagaagcaattgcttcccttttctacccgaagc
actgcagacaatggaaaagacaaagaagcaattcccatttctactgaaaactattcaagt
ggcaaggagaatgcaccagttgccaattgtacagggaagtttaccaatggtgaaatctag

DBGET integrated database retrieval system