KEGG   Solanum lycopersicum (tomato): 544175Help
Entry
544175            CDS       T02665                                 

Gene name
LIN8
Definition
(RefSeq) invertase 8
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00052  Galactose metabolism
sly00500  Starch and sucrose metabolism
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    544175 (LIN8)
   00500 Starch and sucrose metabolism
    544175 (LIN8)
Enzymes [BR:sly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     544175 (LIN8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C CNV-Replicase_N
Motif
Other DBs
NCBI-GeneID: 544175
NCBI-ProteinID: NP_001311325
UniProt: K4D3B7 Q8LRN6
Position
10
AA seq 589 aa AA seqDB search
MDCFKKSFLFSLPFFLLYFSIILSFNNGVNASHRVFPGLQSTSAVDVKNVHRTRYHFQPP
KNWINDPNAPMYYNGVYHLFYQYNPYGSVWGNIVWAHSVSTDLINWIPLEPAIYPSKVFD
KYGTWSGSATILPDNKPIILYTGIVDAKNTQVQNYAIPADLSDPFLRKWIKPDNNPLIDA
DVNINKTQFRDPTTCWLGQDGHWRTLIGSLWGNKGMAILYKSRDLMKWTKVQQPLHSVDG
TGNWECPDFFPVLLRGTNGLDASYKGENIKYVLKVSLDVTRFEYYTVGIYDTKKDKYIPD
KTSIDGWKGLRLDYGNYYASKSFYDPSKNRRIVWGWANESDTVNDDVKKGWAGIQTIPRK
IWLDSSGKQLVQWPVEELESLRGHKIQLSNRKLNKGDKIAVKGITPAQADVEVIFSFSSL
DKAEPFDPNWANLYAQDVCAIKGSTVQGGLGPFGLLTLASKNLEEYTPVFFRVFKAHDKY
KVLMCSDASRSTLENAKTMYKPSFAGYVDVDLTNKTLSLRSLIDHSVVESFGAGGKTCIT
SRVYPTLAIYDNAHLFVFNNGTETIKIESLNAWSMGKPKMNWSFGHSSY
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggattgttttaaaaagtcttttcttttttctttgccattttttttgttatatttctcc
ataattttatctttcaacaatggcgttaatgcttcacacagagtttttccagggttgcaa
tctacgagcgcggttgacgtgaaaaatgttcatagaactcgttatcattttcaacctcct
aaaaactggattaatgatcccaatgcccccatgtactataatggtgtctatcatctattc
taccaatacaatccatatgggtcagtatggggcaatattgtttgggcccattcagtttca
acggacttgattaattggatcccacttgaacccgcaatctatccatccaaagtatttgac
aaatatggtacatggtccgggtcagccacaatcttacccgacaacaagcccattatcctc
tacaccggaatcgtagatgcaaaaaatacccaagtccaaaactatgcaatcccagcggac
ttatccgacccatttcttcgtaaatggatcaagcccgataacaatccattaattgacgct
gacgttaacattaacaagacccaattccgtgacccaaccacgtgttggttgggtcaggat
ggtcattggagaaccttgataggaagtttatggggaaataaagggatggcaatattgtat
aaaagtagagatttaatgaaatggaccaaggtccaacaaccactacattcagttgatggt
actggaaattgggaatgtcctgatttttttccagtgttattgcgcggtacaaatggattg
gatgcatcgtacaaaggggaaaatattaaatatgtccttaaagttagccttgatgttacg
aggtttgaatactataccgttggaatatatgatacgaaaaaagacaagtatattccagat
aagacttctatcgatggttggaagggattgagacttgattatggtaattattacgcatcc
aaatcattttatgaccctagcaagaatcgaagaattgtgtggggttgggctaacgaatca
gatactgtcaatgacgatgttaagaaaggatgggcgggaatacaaactattcctcgtaaa
atatggcttgattcgagcggaaaacaattggttcaatggcctgtcgaagaattagaaagt
ctaagagggcataagatccaattaagcaatcgtaagttaaacaaaggagataaaattgca
gttaaaggaatcacaccagcacaggccgatgttgaagtgatattctcattttcaagcttg
gataaggcagagccatttgatcccaattgggctaacctttatgctcaagatgtatgtgct
attaaaggctcaacggtgcaaggtggacttgggccatttgggctcttaactttggcttct
aaaaatttggaagaatatacgccggtatttttcagagtttttaaggctcacgataaatat
aaggttctcatgtgctctgatgcctcaagatcaaccctcgagaatgctaagacaatgtac
aagccatcatttgctggatatgtagatgtagatttaacaaacaagacattgtctttgagg
agtttgattgatcactcagtagtagaaagttttggtgccggaggaaaaacatgtatcaca
tcaagggtgtatccgacattagcaatttatgacaatgcacatctatttgtctttaataat
gggacagagactatcaaaattgagtcattgaatgcatggagcatgggtaaacctaaaatg
aactggtcatttggtcactcttcttattaa

DBGET integrated database retrieval system