KEGG   Solanum lycopersicum (tomato): 778243Help
Entry
778243            CDS       T02665                                 

Gene name
pmt
Definition
(RefSeq) putrescine N-methyltransferase
  KO
K05353  
putrescine N-methyltransferase [EC:2.1.1.53]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Tropane, piperidine and pyridine alkaloid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    778243 (pmt)
Enzymes [BR:sly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.53  putrescine N-methyltransferase
     778243 (pmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
6
AA seq 340 aa AA seqDB search
MEVIMNNHNNGTINTNTKIIHKNGSICNGNGNVNGNSHTHNNENKLVEFTNSIKPGWFSE
FSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI
VHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYPSIEKIDIVEIDDVVVDVSRKFFPYLAAG
FDDPRVSLIIGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGV
VCTQAESIWLHMHLIKKIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVNFK
NPVNSIDKYVKSKGPLKFYNSDIHKSAFILPSFARDLIES
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcataatgaacaatcacaacaatggcaccatcaacaccaacaccaaaattatt
cacaaaaatggtagcatttgcaatggcaatggcaatgttaatggcaactcccacacccat
aacaatgaaaataagcttgtagagttcactaactctatcaaaccgggttggttttctgag
ttcagcgcactctggccaggtgaagcattttcacttaaaattgaaaaattactattccaa
ggaaagtctgattatcaagatgttatgctctttgagtcagcaacgtatgggaaggtatta
acattggatggggcaattcaacacacagagaatggtggatttccctacactgagatgatt
gttcatctaccacttggttccattccatcccctaaaaaggtgttaatcatcggtggaggg
attggtttcacgttgtttgaggtctctcgctatccaagtattgaaaaaatagacatagtt
gagatcgatgacgtggttgtagacgtatctagaaagtttttcccatacctagcagcagga
tttgatgatccaagagtcagccttattattggcgatggagctgcatttgtgaaagctgct
caacctggatactatgatgcaattattgttgactcttctgatcctattggtccagcaaaa
gacttgtttgaaaggccatttttcgaagcagtggcaaaagccctaaggccaggaggagta
gtgtgtacacaggcagaaagtatttggcttcacatgcatctaattaaaaaaattattgca
aattgtcgacaggtctttaagggttctgtcaattatgcatggactaccgttcctacttac
cctactggtgtgattggttacatgctttgctctacggagggaccagaagttaatttcaag
aatccagtgaactctattgacaaatatgtcaaatccaagggacctttgaagttctataac
tctgatattcataaatcagcttttattttgccgtcttttgcaagggatttgattgaatct
tga

DBGET integrated database retrieval system